Western Blot (WB)
(Host: RabbitTarget Name: Ldlrap1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Rabbit Ldlrap1 Polyclonal Antibody | anti-LDLRAP1 antibody
Ldlrap1 Antibody - C-terminal region
Gene Names
Ldlrap1; Arh; ARH2; Arh1; FHCB1; FHCB2; AA691260
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Ldlrap1; Polyclonal Antibody; Ldlrap1 Antibody - C-terminal region; anti-LDLRAP1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: APLSTVSANTNNVDETPRPQVLGNNSVVWELDDGLDEAFSRLAQSRTNPQ
Sequence Length
264
Applicable Applications for anti-LDLRAP1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Ldlrap1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: Ldlrap1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: Ldlrap1Sample Type: Mouse Testis lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LDLRAP1 antibody
This is a rabbit polyclonal antibody against Ldlrap1. It was validated on Western Blot
Target Description: Ldlrap1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). It may be required for LDL binding and internalization but not for receptor clustering in coated pits. It may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. Ldlrap1 may also be involved in the internalization of other LDLR family members. Ldlrap1 binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.
Target Description: Ldlrap1 is an adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). It may be required for LDL binding and internalization but not for receptor clustering in coated pits. It may facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. Ldlrap1 may also be involved in the internalization of other LDLR family members. Ldlrap1 binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.
Product Categories/Family for anti-LDLRAP1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29kDa
NCBI Official Full Name
low density lipoprotein receptor adapter protein 1
NCBI Official Synonym Full Names
low density lipoprotein receptor adaptor protein 1
NCBI Official Symbol
Ldlrap1
NCBI Official Synonym Symbols
Arh; ARH2; Arh1; FHCB1; FHCB2; AA691260
NCBI Protein Information
low density lipoprotein receptor adapter protein 1
UniProt Protein Name
Low density lipoprotein receptor adapter protein 1
Protein Family
UniProt Gene Name
Ldlrap1
Uniprot Description
Adapter protein (clathrin-associated sorting protein (CLASP)) required for efficient endocytosis of the LDL receptor (LDLR) in polarized cells such as hepatocytes and lymphocytes, but not in non-polarized cells (fibroblasts). May be required for LDL binding and internalization but not for receptor clustering in coated pits. May facilitate the endocytocis of LDLR and LDLR-LDL complexes from coated pits by stabilizing the interaction between the receptor and the structural components of the pits. May also be involved in the internalization of other LDLR family members. Binds to phosphoinositides, which regulate clathrin bud assembly at the cell surface.
Research Articles on LDLRAP1
Similar Products
Product Notes
The LDLRAP1 ldlrap1 (Catalog #AAA3212150) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Ldlrap1 Antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Ldlrap1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LDLRAP1 ldlrap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: APLSTVSANT NNVDETPRPQ VLGNNSVVWE LDDGLDEAFS RLAQSRTNPQ. It is sometimes possible for the material contained within the vial of "Ldlrap1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
