Rabbit LDHB Polyclonal Antibody | anti-LDHB antibody

LDHB Antibody - C-terminal region

Cat. Num. AAA3208923

• Gene Names: LDHB; LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: LDHB; Polyclonal Antibody; LDHB Antibody - C-terminal region; anti-LDHB antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MYGIENEVFLSLPCILNARGLTSVINQKLKDDEVAQLKKSADTLWDIQKD
• Sequence Length: 334

• Applicable Applications for anti-LDHB antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 91%
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDHB
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-LDHB AntibodyParaffin Embedded Tissue: Human PlacentaAntibody Concentration: 5 ug/ml)

Immunohistochemistry (IHC)

(Researcher: Dr. Crissy Dudgeon, Ph.D., CINJApplication: IHCSpecies+tissue/cell type: Human lung adenocarcinoma cell line A549Primary antibody dilution: 1:100Secondary antibody: Goat anti-rabbit AlexaFluor 488Secondary antibody dilution: 1:400)

Western Blot (WB)

(Host: RabbitTarget Name: LDHBSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: LDHBSample Tissue: Human 293T Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: LDHBSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: LDHBSample Tissue: Human THP-1 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Host: RabbitTarget Name: LDHBSample Type: Human Fetal LungLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/laneGel Concentration: 0.12)

Western Blot (WB)

(Host: RabbitTarget Name: LDHBSample Type:Lane A: Human Fetal LungLane B: Human HCT116Lane C: Human 293TAntibody Dilution: 0.2ug/ml)

Western Blot (WB)

(Lanes:1. 30 ug MiaPaca-2 cell lysate2. 30 ug Panc-1 cell lysatePrimary Antibody Dilution:1:1000Secondary Antibody:Goat anti-Rabbit HRPSecondary Antibody Dilution:1:4000Gene Name:LDHBSubmitted by:Dr. Crissy Dudgeon, Ph.D., CINJ)

Western Blot (WB)

(WB Suggested Anti-LDHB antibody Titration: 1 ug/mLSample Type: Human 721_B )

Western Blot (WB)

(WB Suggested Anti-LDHB antibody Titration: 1 ug/mLSample Type: Human Raji )

Western Blot (WB)

(WB Suggested Anti-LDHB AntibodyTitration: 1 ug/mlPositive Control: 721_B Whole CellLDHB is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Related Product Information for anti-LDHB antibody

This is a rabbit polyclonal antibody against LDHB. It was validated on Western Blot

Target Description: This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13.

Product Categories/Family for anti-LDHB antibody

Polyclonal; Drugs and Drug Metabolism; Various; E3 & Ubiquitin; Disease Related; DNA/RNA/Protein Interactions; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 4557032
• NCBI GeneID: 3945
• NCBI Accession #: NP_002291
• NCBI GenBank Nucleotide #: NM_002300
• UniProt Accession #: P07195
• Molecular Weight: 37kDa
• NCBI Official Full Name: L-lactate dehydrogenase B chain isoform LDHB
• NCBI Official Synonym Full Names: lactate dehydrogenase B
• NCBI Official Symbol: LDHB
• NCBI Official Synonym Symbols: LDH-B; LDH-H; LDHBD; TRG-5; HEL-S-281
• NCBI Protein Information: L-lactate dehydrogenase B chain
• UniProt Protein Name: L-lactate dehydrogenase B chain
• Protein Family: L-lactate dehydrogenase
• UniProt Gene Name: LDHB
• UniProt Synonym Gene Names: LDH-B; LDH-H
• UniProt Entry Name: LDHB_HUMAN

NCBI Description

This gene encodes the B subunit of lactate dehydrogenase enzyme, which catalyzes the interconversion of pyruvate and lactate with concomitant interconversion of NADH and NAD+ in a post-glycolysis process. Alternatively spliced transcript variants have been found for this gene. Recent studies have shown that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on chromosomes X, 5 and 13. [provided by RefSeq, Feb 2016]