Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-LDB3 Antibody Titration: 0.625ug/mlPositive Control: Human heart)

Rabbit LDB3 Polyclonal Antibody | anti-LDB3 antibody

LDB3 antibody - N-terminal region

Gene Names
LDB3; MFM4; ZASP; CMD1C; CMH24; CMPD3; LVNC3; CYPHER; LDB3Z1; LDB3Z4; ORACLE; PDLIM6
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
LDB3; Polyclonal Antibody; LDB3 antibody - N-terminal region; anti-LDB3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PVIPHQKDPALDTNGSLVAPSPSPEARASPGTPGTPELRPTFSPAFSRPS
Sequence Length
330
Applicable Applications for anti-LDB3 antibody
Western Blot (WB)
Homology
Cow: 93%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human LDB3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-LDB3 Antibody Titration: 0.625ug/mlPositive Control: Human heart)

Western Blot (WB) (WB Suggested Anti-LDB3 Antibody Titration: 0.625ug/mlPositive Control: Human heart)
Related Product Information for anti-LDB3 antibody
This is a rabbit polyclonal antibody against LDB3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: LDB3 may function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton.
Product Categories/Family for anti-LDB3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
LIM domain-binding protein 3 isoform 3
NCBI Official Synonym Full Names
LIM domain binding 3
NCBI Official Symbol
LDB3
NCBI Official Synonym Symbols
MFM4; ZASP; CMD1C; CMH24; CMPD3; LVNC3; CYPHER; LDB3Z1; LDB3Z4; ORACLE; PDLIM6
NCBI Protein Information
LIM domain-binding protein 3
UniProt Protein Name
LIM domain-binding protein 3
UniProt Gene Name
LDB3
UniProt Entry Name
LDB3_HUMAN

NCBI Description

This gene encodes a PDZ domain-containing protein. PDZ motifs are modular protein-protein interaction domains consisting of 80-120 amino acid residues. PDZ domain-containing proteins interact with each other in cytoskeletal assembly or with other proteins involved in targeting and clustering of membrane proteins. The protein encoded by this gene interacts with alpha-actinin-2 through its N-terminal PDZ domain and with protein kinase C via its C-terminal LIM domains. The LIM domain is a cysteine-rich motif defined by 50-60 amino acids containing two zinc-binding modules. This protein also interacts with all three members of the myozenin family. Mutations in this gene have been associated with myofibrillar myopathy and dilated cardiomyopathy. Alternatively spliced transcript variants encoding different isoforms have been identified; all isoforms have N-terminal PDZ domains while only longer isoforms (1, 2 and 5) have C-terminal LIM domains. [provided by RefSeq, Jan 2010]

Uniprot Description

LDB3: May function as an adapter in striated muscle to couple protein kinase C-mediated signaling via its LIM domains to the cytoskeleton. Defects in LDB3 are the cause of cardiomyopathy dilated type 1C (CMD1C). Dilated cardiomyopathy is a disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Defects in LDB3 are the cause of left ventricular non- compaction type 3 (LVNC3). Left ventricular non- compaction is characterized by numerous prominent trabeculations and deep intertrabecular recesses in hypertrophied and hypokinetic segments of the left ventricle. Defects in LDB3 are the cause of myopathy myofibrillar type 4 (MFM4). A neuromuscular disorder characterized by distal and proximal muscle weakness with signs of cardiomyopathy and neuropathy. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 10q22.3-q23.2

Cellular Component: cytoskeleton; perinuclear region of cytoplasm; pseudopodium; Z disc

Molecular Function: protein binding; protein kinase C binding; zinc ion binding; cytoskeletal protein binding; muscle alpha-actinin binding

Biological Process: sarcomere organization

Disease: Myopathy, Myofibrillar, 4

Research Articles on LDB3

Similar Products

Product Notes

The LDB3 ldb3 (Catalog #AAA3205930) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LDB3 antibody - N-terminal region reacts with Cow, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LDB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LDB3 ldb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PVIPHQKDPA LDTNGSLVAP SPSPEARASP GTPGTPELRP TFSPAFSRPS. It is sometimes possible for the material contained within the vial of "LDB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.