Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LDB1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human LDB1 Polyclonal Antibody | anti-LDB1 antibody

LDB1 Antibody - C-terminal region

Gene Names
LDB1; NLI; CLIM2; LDB-1; CLIM-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
LDB1; Polyclonal Antibody; LDB1 Antibody - C-terminal region; anti-LDB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VAPPAEPTRQQPSKRRKRKMSGGSTMSSGGGNTNNSNSKKKSPASTFALS
Sequence Length
411
Applicable Applications for anti-LDB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human LDB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LDB1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LDB1Sample Type: Fetal Kidney lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-LDB1 antibody
This is a rabbit polyclonal antibody against LDB1. It was validated on Western Blot

Target Description: LDB1 binds to the LIM domain of a wide variety of LIM domain- containing transcription factors. It may regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. It plays a role in the development of interneurons and motor neurons in cooperation with LHX3 and ISL1. It acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. It acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45kDa
NCBI Official Full Name
LIM domain-binding protein 1 isoform 1
NCBI Official Synonym Full Names
LIM domain binding 1
NCBI Official Symbol
LDB1
NCBI Official Synonym Symbols
NLI; CLIM2; LDB-1; CLIM-2
NCBI Protein Information
LIM domain-binding protein 1
UniProt Protein Name
LIM domain-binding protein 1
UniProt Gene Name
LDB1
UniProt Synonym Gene Names
CLIM2; LDB-1; CLIM-2; hLdb1
UniProt Entry Name
LDB1_HUMAN

Uniprot Description

LDB1: Binds to the LIM domain of a wide variety of LIM domain- containing transcription factors. May regulate the transcriptional activity of LIM-containing proteins by determining specific partner interactions. May play a role in the development of motor neurons. Acts synergistically with LHX1/LIM1 in axis formation and activation of gene expression. Acts with LMO2 in the regulation of red blood cell development, maintaining erythroid precursors in an immature state. Belongs to the LDB family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor

Chromosomal Location of Human Ortholog: 10q24-q25

Cellular Component: transcription factor complex; protein complex; nuclear chromatin; nucleus

Molecular Function: LIM domain binding; enzyme binding; protein homodimerization activity; protein self-association; chromatin binding; transcription corepressor activity

Biological Process: transcription from RNA polymerase II promoter; negative regulation of erythrocyte differentiation; positive regulation of cell adhesion; Wnt receptor signaling pathway; transcription, DNA-dependent; somatic stem cell maintenance; multicellular organismal development; gastrulation with mouth forming second; positive regulation of hemoglobin biosynthetic process; cellular component assembly; neuron differentiation; regulation of transcription, DNA-dependent; hair follicle development; cerebellar Purkinje cell differentiation; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; regulation of RNA elongation; anterior/posterior axis specification

Research Articles on LDB1

Similar Products

Product Notes

The LDB1 ldb1 (Catalog #AAA3219510) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LDB1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LDB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LDB1 ldb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VAPPAEPTRQ QPSKRRKRKM SGGSTMSSGG GNTNNSNSKK KSPASTFALS. It is sometimes possible for the material contained within the vial of "LDB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.