Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- LCAT Picoband antibody, MBS177677, Western blottingAll lanes: Anti LCAT (MBS177677) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD )

Rabbit LCAT Polyclonal Antibody | anti-LCAT antibody

Anti-LCAT Antibody

Gene Names
Lcat; AI046659; D8Wsu61e
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
LCAT; Polyclonal Antibody; Anti-LCAT Antibody; Phosphatidylcholine-sterol acyltransferase; LCAT_HUMAN; Lecithin cholesterol acyltransferase; Lecithin-cholesterol acyltransferase; Phosphatidylcholine sterol acyltransferase; Phospholipid cholesterol acyltransferase; Phospholipid-cholesterol acyltransferase antibody; lecithin-cholesterol acyltransferase; anti-LCAT antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
Rabbit IgG
Specificity
No cross reactivity with other proteins
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized.
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
438
Applicable Applications for anti-LCAT antibody
Western Blot (WB)
Application Notes
Western Blot
Concentration: 0.1-0.5ug/ml
Tested Species: Hu, Ms, Rat

Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Gene name
Lecithin-cholesterol acyltransferase
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of mouse LCAT (389-423aa QPVHLLPMNETDHLNMVFSNKTLEHINAILLGAYR), different from the related human sequence by six amino acids, and from the related rat sequence by four amino acids.
Reconstitution
0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- LCAT Picoband antibody, MBS177677, Western blottingAll lanes: Anti LCAT (MBS177677) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD )

Western Blot (WB) (Anti- LCAT Picoband antibody, MBS177677, Western blottingAll lanes: Anti LCAT (MBS177677) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: Mouse Testis Tissue Lysate at 50ugLane 3: HEPG2 Whole Cell Lysate at 40ugLane 4: HELA Whole Cell Lysate at 40ugPredicted bind size: 50KDObserved bind size: 50KD )
Related Product Information for anti-LCAT antibody
Description: Rabbit IgG polyclonal antibody for Phosphatidylcholine-sterol acyltransferase(LCAT) detection. Tested with WB in Human;Mouse;Rat.

Background: LCAT (Lecithin: Cholesterol Acyltransferase), is an enzyme that converts free cholesterol into cholesteryl ester. Azoulay et al. (1987) used a cDNA clone corresponding to LCAT to assign the locus to 16q22 through the analysis of DNA from somatic cell hybrids and in situ hybridization. LCAT plays an important role in lipoprotein metabolism, especially in the process termed 'reverse cholesterol transport.' The enzyme is synthesized in the liver and circulates in blood plasma as a complex with components of high density lipoprotein (HDL). Cholesterol from peripheral cells is transferred to HDL particles, esterified through the action of LCAT on HDL, and incorporated into the core of the lipoprotein. The cholesterol ester is thereby transported to the liver (Jonas, 2000).
References
1. Azoulay, M., Henry, I., Tata, F., Weil, D., Grzeschik, K. H., Chaves, E., McIntyre, N., Williamson, R., Humphries, S. E., Junien, C. The structural gene for lecithin:cholesterol acyl transferase (LCAT) maps to 16q22. Ann. Hum. Genet. 51: 129-136, 1987. 2. Frohlich, J., McLeod, R., Hon, K. Lecithin:cholesterol acyl transferase (LCAT). Clin. Biochem. 15: 269-278, 1982. 3. Jonas, A. Lecithin cholesterol acyltransferase. Biochim. Biophys. Acta 1529: 245-256, 2000.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49,747 Da
NCBI Official Full Name
phosphatidylcholine-sterol acyltransferase
NCBI Official Synonym Full Names
lecithin cholesterol acyltransferase
NCBI Official Symbol
Lcat
NCBI Official Synonym Symbols
AI046659; D8Wsu61e
NCBI Protein Information
phosphatidylcholine-sterol acyltransferase
UniProt Protein Name
Phosphatidylcholine-sterol acyltransferase
UniProt Gene Name
Lcat
UniProt Entry Name
LCAT_MOUSE

Uniprot Description

LCAT: Central enzyme in the extracellular metabolism of plasma lipoproteins. Synthesized mainly in the liver and secreted into plasma where it converts cholesterol and phosphatidylcholines (lecithins) to cholesteryl esters and lysophosphatidylcholines on the surface of high and low density lipoproteins (HDLs and LDLs). The cholesterol ester is then transported back to the liver. Has a preference for plasma 16:0-18:2 or 18:O-18:2 phosphatidylcholines. Also produced in the brain by primary astrocytes, and esterifies free cholesterol on nascent APOE-containing lipoproteins secreted from glia and influences cerebral spinal fluid (CSF) APOE- and APOA1 levels. Together with APOE and the cholesterol transporter ABCA1, plays a key role in the maturation of glial-derived, nascent lipoproteins. Required for remodeling high-density lipoprotein particles into their spherical forms. Defects in LCAT are the cause of lecithin-cholesterol acyltransferase deficiency (LCATD); also called Norum disease. LCATD is a disorder of lipoprotein metabolism characterized by inadequate esterification of plasmatic cholesterol. Two clinical forms are recognized: familial LCAT deficiency and fish-eye disease. Familial LCAT deficiency is associated with a complete absence of alpha and beta LCAT activities and results in esterification anomalies involving both HDL (alpha-LCAT activity) and LDL (beta-LCAT activity). It causes a typical triad of diffuse corneal opacities, target cell hemolytic anemia, and proteinuria with renal failure. Defects in LCAT are a cause of fish-eye disease (FED); also known as dyslipoproteinemic corneal dystrophy or alpha-LCAT deficiency. FED is due to a partial LCAT deficiency that affects only alpha-LCAT activity. It is characterized by low plasma HDL and corneal opacities due to accumulation of cholesterol deposits in the cornea ('fish-eye'). Belongs to the AB hydrolase superfamily. Lipase family.

Protein type: Secreted, signal peptide; Transferase; EC 2.3.1.43; Secreted; Lipid Metabolism - glycerophospholipid

Cellular Component: extracellular region; extracellular space

Molecular Function: apolipoprotein A-I binding; O-acyltransferase activity; phosphatidylcholine-sterol O-acyltransferase activity; phospholipase A2 activity; transferase activity; transferase activity, transferring acyl groups

Biological Process: cholesterol homeostasis; cholesterol metabolic process; cholesterol transport; lipid metabolic process; lipoprotein biosynthetic process; lipoprotein metabolic process; phosphatidylcholine biosynthetic process; phosphatidylcholine metabolic process; phospholipid metabolic process; response to copper ion; response to glucocorticoid stimulus; reverse cholesterol transport; steroid metabolic process

Research Articles on LCAT

Similar Products

Product Notes

The LCAT lcat (Catalog #AAA177677) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-LCAT Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's LCAT can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml Tested Species: Hu, Ms, Rat Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. Researchers should empirically determine the suitability of the LCAT lcat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "LCAT, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.