Rabbit anti-Human ANAPC10 Polyclonal Antibody | anti-ANAPC10 antibody

ANAPC10 (APC10, Anaphase-promoting Complex Subunit 10, Cyclosome Subunit 10, DKFZp564L0562, DKFZP564L0562, DOC1) (AP)

Cat. Num. AAA6369792

• Gene Names: ANAPC10; DOC1; APC10
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ANAPC10; Polyclonal Antibody; ANAPC10 (APC10; Anaphase-promoting Complex Subunit 10; Cyclosome Subunit 10; DKFZp564L0562; DKFZP564L0562; DOC1) (AP); anti-ANAPC10 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human ANAPC10.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-ANAPC10 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full-length human ANAPC10, aa1-185 (AAH05217.1).
• Immunogen Sequence: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNLETYWQSDGSQPHLVNIQFRRKTTVKTLCIYADYKSDESYTPSKISVRVGNNFHNLQEIRQLELVEPSGWIHVPLTDNHKKPTRTFMIQIAVLANHQNGRDTHMRQIKIYTPVEESSIGKFPRCTTIDFMMYRSIR
• Conjugate: AP
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ANAPC10 expression in transfected 293T cell line by ANAPC10 polyclonal antibody. Lane 1: ANAPC10 transfected lysate (21.3kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-ANAPC10 antibody

APC is a ubiquitin ligase which specifically targets mitotic regulatory factors such as Pds 1/Cut 2 and cyclin B. It was found that APC 10/Doc 1 is localized in centrosomes and mitotic spindles throughout mitosis, while it is also localized in kinetochores from prophase to anaphase and in mid body in telophase and cytokinesis. These results strongly support the notion that human APC 10/Doc 1 may be one of the APC core subunits rather than the transiently associated regulatory factor.

Product Categories/Family for anti-ANAPC10 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 13528833
• NCBI GeneID: 10393
• Molecular Weight: 21,252 Da
• NCBI Official Full Name: Homo sapiens anaphase promoting complex subunit 10, mRNA
• NCBI Official Synonym Full Names: anaphase promoting complex subunit 10
• NCBI Official Symbol: ANAPC10
• NCBI Official Synonym Symbols: DOC1; APC10
• NCBI Protein Information: anaphase-promoting complex subunit 10

NCBI Description

ANAPC10 is a core subunit of the anaphase-promoting complex (APC), or cyclosome, a ubiquitin protein ligase that is essential for progression through the cell cycle. APC initiates sister chromatid separation by ubiquitinating the anaphase inhibitor securin (PTTG1; MIM 604147) and triggers exit from mitosis by ubiquitinating cyclin B (CCNB1; MIM 123836), the activating subunit of cyclin-dependent kinase-1 (CDK1; MIM 116940) (summary by Wendt et al., 2001 [PubMed 11524682]).[supplied by OMIM, Feb 2011]