Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: LAT2Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human LAT2 Polyclonal Antibody | anti-LAT2 antibody

LAT2 Antibody - middle region

Gene Names
LAT2; LAB; NTAL; WSCR5; WBSCR5; HSPC046; WBSCR15
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
LAT2; Polyclonal Antibody; LAT2 Antibody - middle region; anti-LAT2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EEAYIDPIAMEYYNWGRFSKPPEDDDANSYENVLICKQKTTETGAQQEGI
Sequence Length
243
Applicable Applications for anti-LAT2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human LAT2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: LAT2Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: LAT2Sample Tissue: Human COLO205 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-LAT2 antibody
This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein.
Product Categories/Family for anti-LAT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26 kDa
NCBI Official Full Name
linker for activation of T-cells family member 2
NCBI Official Synonym Full Names
linker for activation of T cells family member 2
NCBI Official Symbol
LAT2
NCBI Official Synonym Symbols
LAB; NTAL; WSCR5; WBSCR5; HSPC046; WBSCR15
NCBI Protein Information
linker for activation of T-cells family member 2
UniProt Protein Name
Linker for activation of T-cells family member 2
UniProt Gene Name
LAT2
UniProt Synonym Gene Names
LAB; NTAL; WBS15; WBSCR15; WBSCR5
UniProt Entry Name
NTAL_HUMAN

NCBI Description

This gene is one of the contiguous genes at 7q11.23 commonly deleted in Williams syndrome, a multisystem developmental disorder. This gene consists of at least 14 exons, and its alternative splicing generates 3 transcript variants, all encoding the same protein. [provided by RefSeq, Jul 2008]

Uniprot Description

LAB: linker for activation of B cells (LAB) is an adaptor protein. B cell antigen receptor signaling leads to its phosphorylation and interaction with the adaptor protein Grb2. Decreased expression leads to a reduction in BCR-mediated calcium flux and Erk activation. Localized to lipid rafts.

Protein type: Adaptor/scaffold; Membrane protein, integral

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: mast cell granule; integral to membrane; plasma membrane; lipid raft

Molecular Function: protein binding; SH2 domain binding

Biological Process: B cell receptor signaling pathway; B cell activation; calcium-mediated signaling; innate immune response; mast cell degranulation

Research Articles on LAT2

Similar Products

Product Notes

The LAT2 lat2 (Catalog #AAA3219769) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The LAT2 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's LAT2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the LAT2 lat2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EEAYIDPIAM EYYNWGRFSK PPEDDDANSY ENVLICKQKT TETGAQQEGI. It is sometimes possible for the material contained within the vial of "LAT2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.