Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data

Rabbit anti-Mouse, Rat Kv1.1 Polyclonal Antibody | anti-Kv1.1 antibody

Anti-Kv1.1 Antibody

Reactivity
Mouse, Rat
Applications
Western Blot, Immunohistochemistry, Immunoprecipitation
Purity
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to Kv1.2 by affinity chromatography on immobilized Kv1.2-GST-fusion protein, and then the antibody was Affinity Purified on immo
Synonyms
Kv1.1; Polyclonal Antibody; Anti-Kv1.1 Antibody; K v1-1; anti-Kv1.1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse, Rat
Clonality
Polyclonal
Specificity
Rat, human, Xenopus-respectively, 78/80, 76/80, and 70/80 residues identical.
Purity/Purification
The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to Kv1.2 by affinity chromatography on immobilized Kv1.2-GST-fusion protein, and then the antibody was Affinity Purified on immo
Form/Format
Liquid; PBS, pH 7.4 with 0.05% sodium azide.
Concentration
1ug/ul (varies by lot)
Applicable Applications for anti-Kv1.1 antibody
Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP)
Application Notes
WB: Rat brain membranes (1:200)
IHC: Rat brain sections
Immunogen
GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRT GNCTTADQNCVNKSKLLTDV, corresponding to residues 416-495 of mouse KV1.1 (Accession P16388).
Preparation and Storage
This product is stable for several weeks at 4 degree C as an undiluted liquid. Dilute only prior to immediate use.
For extended storage, aliquot contents and freeze at-20 degree C or below. Avoid cycles of freezing and thawing. Expiration date is one (1) year from date of receipt.

Testing Data

Testing Data
Related Product Information for anti-Kv1.1 antibody
Voltage-gated K+ channel subfamily A member 1, Kcna1 KV1.1 is a mammalian voltage dependent K+ channel, homologous to the Drosophilae Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes.2 A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function. The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. 2 The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.3 KV1.1 channels are sensitive to low doses of TEA (0.3 mM) and 4-AP (0.29 mM), the (0.3 mM) and 4-AP (0.29 mM)

Similar Products

Product Notes

The Kv1.1 (Catalog #AAA4159189) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-Kv1.1 Antibody reacts with Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Kv1.1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC), Immunoprecipitation (IP). WB: Rat brain membranes (1:200) IHC: Rat brain sections. Researchers should empirically determine the suitability of the Kv1.1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Kv1.1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.