Mouse anti-Human KRR1 Polyclonal Antibody | anti-KRR1 antibody

KRR1 (KRR1 Small Subunit Processome Component Homolog, HIV-1 Rev-binding Protein 2, KRR-R Motif-containing Protein 1, Rev-interacting Protein 1, Rip-1, HRB2)

Cat. Num. AAA6012939

• Gene Names: KRR1; HRB2; RIP-1
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: KRR1; Polyclonal Antibody; KRR1 (KRR1 Small Subunit Processome Component Homolog; HIV-1 Rev-binding Protein 2; KRR-R Motif-containing Protein 1; Rev-interacting Protein 1; Rip-1; HRB2); Anti -KRR1 (KRR1 Small Subunit Processome Component Homolog; anti-KRR1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human KRR1.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MASPSLERPEKGAGKSEFRNQKPKPENQDESELLTVPDGWKEPAFSKEDNPRGLLEESSFATLFPKYREAYLKECWPLVQKALNEHHVNATLDLIEGSMTVCTTKKTFDPYIIIRARDLIKLLARSVSFEQAVRILQDDVACDIIKIGSLVRNKERFVKRRQRLIGPKGSTLKALELLTNCYIMVQGNTVSAIGPFSGLKEVRKVALDTMKNIHPIYNIKSLMIKRELAKDSELRSQSWERFLPQFKHKNVNKRKEPKKKTVKKEYTPFPPPQPESQIDKELASGEYFLKANQKKRQKMEAIKAKQAEAISKRQEERNKAFIPPKEKPIVKPKEASTETKIDVASIKEKVKKAKNKKLGALTAEEIALKMEADEKKKKKKK

• Applicable Applications for anti-KRR1 antibody: Western Blot (WB)
• Application Notes: Suitable for use in Western Blot.
• Immunogen: Full length human KRR1, aa1-381 (AAH26107.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HRB2 polyclonal antibody. Western Blot analysis of HRB2 expression in human pancreas.)

Western Blot (WB)

(KRR1 polyclonal antibody. Western Blot analysis of KRR1 expression in HeLa.)

Western Blot (WB)

(Western Blot analysis of KRR1 expression in transfected 293T cell line by KRR1 polyclonal antibody. Lane 1: HRB2 transfected lysate (41.91kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-KRR1 antibody

Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly (By similarity).

Product Categories/Family for anti-KRR1 antibody

Antibodies; Abs to Cell Markers

NCBI and Uniprot Product Information

• NCBI GI #: 117676403
• NCBI GeneID: 11103
• NCBI Accession #: NP_008974.5
• NCBI GenBank Nucleotide #: NM_007043.6
• UniProt Accession #: Q13601; Q8NEA8; Q8TC37; Q96AT5; A0FIK6; A0JLP0; B2R989; E7EUQ0
• Molecular Weight: 43,665 Da
• NCBI Official Full Name: KRR1 small subunit processome component homolog
• NCBI Official Synonym Full Names: KRR1, small subunit (SSU) processome component, homolog (yeast)
• NCBI Official Symbol: KRR1
• NCBI Official Synonym Symbols: HRB2; RIP-1
• NCBI Protein Information: KRR1 small subunit processome component homolog; Rev interacting protein; rev-interacting protein 1; HIV-1 Rev binding protein 2; HIV-1 Rev-binding protein 2; KRR-R motif-containing protein 1
• UniProt Protein Name: KRR1 small subunit processome component homolog
• Protein Family: KRR1 small subunit processome component
• UniProt Gene Name: KRR1
• UniProt Synonym Gene Names: HRB2; Rip-1
• UniProt Entry Name: KRR1_HUMAN

Uniprot Description

KRR1: Required for 40S ribosome biogenesis. Involved in nucleolar processing of pre-18S ribosomal RNA and ribosome assembly. Belongs to the KRR1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA processing; Nucleolus

Chromosomal Location of Human Ortholog: 12q21.2

Cellular Component: small subunit processome; intercellular bridge; membrane; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding

Biological Process: maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)