Western Blot (WB)
(Host: RabbitTarget Name: KNG1Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Rabbit KNG1 Polyclonal Antibody | anti-KNG1 antibody
KNG1 Antibody - N-terminal region
Gene Names
KNG1; BK; BDK; KNG; HMWK
Reactivity
Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
KNG1; Polyclonal Antibody; KNG1 Antibody - N-terminal region; anti-KNG1 antibody
Host
Rabbit
Reactivity
Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALKKYNSQNQSNNQFVLYRITEATKTVGSDTFYSFKYEIKEGDCPVQSGK
Sequence Length
391
Applicable Applications for anti-KNG1 antibody
Western Blot (WB)
Homology
Human: 100%; Pig: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human KNG1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KNG1Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KNG1Sample Type: Placenta lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-KNG1 antibody
This is a rabbit polyclonal antibody against KNG1. It was validated on Western Blot
Target Description: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Target Description: Kininogens are inhibitors of thiol proteases. HMW-kininogen plays an important role in blood coagulation by helping to position optimally prekallikrein and factor XI next to factor XII and inhibits the thrombin- and plasmin-induced aggregation of thrombocytes. The active peptide bradykinin that is released from HMW-kininogen shows a variety of physiological effects such as influence in smooth muscle contraction, induction of hypotension, natriuresis and diuresis, etc.
Product Categories/Family for anti-KNG1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
43kDa
NCBI Official Full Name
kininogen-1 isoform 3
NCBI Official Synonym Full Names
kininogen 1
NCBI Official Symbol
KNG1
NCBI Official Synonym Symbols
BK; BDK; KNG; HMWK
NCBI Protein Information
kininogen-1
Protein Family
NCBI Description
This gene uses alternative splicing to generate two different proteins- high molecular weight kininogen (HMWK) and low molecular weight kininogen (LMWK). HMWK is essential for blood coagulation and assembly of the kallikrein-kinin system. Also, bradykinin, a peptide causing numerous physiological effects, is released from HMWK. Bradykinin also functions as an antimicrobial peptide with antibacterial and antifungal activity. In contrast to HMWK, LMWK is not involved in blood coagulation. Three transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2014]
Research Articles on KNG1
Similar Products
Product Notes
The KNG1 (Catalog #AAA3214229) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KNG1 Antibody - N-terminal region reacts with Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KNG1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KNG1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALKKYNSQNQ SNNQFVLYRI TEATKTVGSD TFYSFKYEIK EGDCPVQSGK. It is sometimes possible for the material contained within the vial of "KNG1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
