Immunohistochemistry (IHC)
(Rabbit Anti-SUV420H1 AntibodyCellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)
Rabbit KMT5B Polyclonal Antibody | anti-KMT5B antibody
KMT5B Antibody - C-terminal region
Gene Names
KMT5B; CGI85; MRD51; CGI-85; SUV420H1
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
KMT5B; Polyclonal Antibody; KMT5B Antibody - C-terminal region; anti-KMT5B antibody
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NNGFNSGSGSSSTKLKIQLKRDEENRGSYTEGLHENGVCCSDPLSLLESR
Sequence Length
471
Applicable Applications for anti-KMT5B antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Dog: 86%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 91%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SUV420H1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-SUV420H1 AntibodyCellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)
Immunohistochemistry (IHC)
(Rabbit Anti-SUV420H1 AntibodyCellular Data: Squamous epithelial cells Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X)
Western Blot (WB)
(WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-SUV420H1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-SUV420H1 AntibodyTitration: 1.25 ug/mlPositive Control: Jurkat Whole Cell)
Western Blot (WB)
(WB Suggested Anti-SUV420H1 AntibodyTitration: 1.25 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-KMT5B antibody
This is a rabbit polyclonal antibody against SUV420H1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Target Description: This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-KMT5B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52kDa
NCBI Official Full Name
SUV420H1 protein
NCBI Official Synonym Full Names
lysine methyltransferase 5B
NCBI Official Symbol
KMT5B
NCBI Official Synonym Symbols
CGI85; MRD51; CGI-85; SUV420H1
NCBI Protein Information
histone-lysine N-methyltransferase KMT5B
Protein Family
NCBI Description
This gene encodes a protein that contains a SET domain. SET domains appear to be protein-protein interaction domains that mediate interactions with a family of proteins that display similarity with dual-specificity phosphatases (dsPTPases). The function of this gene has not been determined. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2014]
Research Articles on KMT5B
Similar Products
Product Notes
The KMT5B (Catalog #AAA3202142) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KMT5B Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KMT5B can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KMT5B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NNGFNSGSGS SSTKLKIQLK RDEENRGSYT EGLHENGVCC SDPLSLLESR. It is sometimes possible for the material contained within the vial of "KMT5B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
