Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KLRB1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KLRB1 Polyclonal Antibody | anti-KLRB1 antibody

KLRB1 Antibody - middle region

Gene Names
KLRB1; NKR; CD161; CLEC5B; NKR-P1; NKRP1A; NKR-P1A; hNKR-P1A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KLRB1; Polyclonal Antibody; KLRB1 Antibody - middle region; anti-KLRB1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNWKWINGSFLNSNDLEIRGDAKENSCISISQTSVYSEYCSTEIRWICQK
Sequence Length
225
Applicable Applications for anti-KLRB1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KLRB1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KLRB1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KLRB1Sample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KLRB1 antibody
Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein is classified as a type II membrane protein because it has an external C terminus.
Product Categories/Family for anti-KLRB1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25 kDa
NCBI Official Full Name
killer cell lectin-like receptor subfamily B member 1
NCBI Official Synonym Full Names
killer cell lectin like receptor B1
NCBI Official Symbol
KLRB1
NCBI Official Synonym Symbols
NKR; CD161; CLEC5B; NKR-P1; NKRP1A; NKR-P1A; hNKR-P1A
NCBI Protein Information
killer cell lectin-like receptor subfamily B member 1
UniProt Protein Name
Killer cell lectin-like receptor subfamily B member 1
UniProt Gene Name
KLRB1
UniProt Synonym Gene Names
CLEC5B; NKRP1A; NKR-P1A
UniProt Entry Name
KLRB1_HUMAN

NCBI Description

Natural killer (NK) cells are lymphocytes that mediate cytotoxicity and secrete cytokines after immune stimulation. Several genes of the C-type lectin superfamily, including the rodent NKRP1 family of glycoproteins, are expressed by NK cells and may be involved in the regulation of NK cell function. The KLRB1 protein contains an extracellular domain with several motifs characteristic of C-type lectins, a transmembrane domain, and a cytoplasmic domain. The KLRB1 protein is classified as a type II membrane protein because it has an external C terminus. [provided by RefSeq, Jul 2008]

Uniprot Description

KLRB1: Plays an inhibitory role on natural killer (NK) cells cytotoxicity. Activation results in specific acid sphingomyelinase/SMPD1 stimulation with subsequent marked elevation of intracellular ceramide. Activation also leads to AKT1/PKB and RPS6KA1/RSK1 kinases stimulation as well as markedly enhanced T-cell proliferation induced by anti-CD3. Acts as a lectin that binds to the terminal carbohydrate Gal-alpha(1,3)Gal epitope as well as to the N-acetyllactosamine epitope. Binds also to CLEC2D/LLT1 as a ligand and inhibits NK cell-mediated cytotoxicity as well as interferon-gamma secretion in target cells.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 12p13

Cellular Component: plasma membrane; integral to membrane

Molecular Function: transmembrane receptor activity; carbohydrate binding

Biological Process: cell surface receptor linked signal transduction

Research Articles on KLRB1

Similar Products

Product Notes

The KLRB1 klrb1 (Catalog #AAA3222397) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLRB1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KLRB1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLRB1 klrb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNWKWINGSF LNSNDLEIRG DAKENSCISI SQTSVYSEYC STEIRWICQK. It is sometimes possible for the material contained within the vial of "KLRB1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.