Rabbit anti-Human KLK8 Polyclonal Antibody | anti-KLK8 antibody

KLK8 (Kallikrein-8, hK8, Neuropsin, NP, Ovasin, Serine Protease 19, Serine Protease TADG-14, Tumor-associated Differentially Expressed Gene 14 Protein, NRPN, PRSS19, TADG14, UNQ283/PRO322) (PE)

Cat. Num. AAA6383761

• Gene Names: KLK8; NP; HNP; NRPN; PRSS19; TADG14
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: KLK8; Polyclonal Antibody; KLK8 (Kallikrein-8; hK8; Neuropsin; NP; Ovasin; Serine Protease 19; Serine Protease TADG-14; Tumor-associated Differentially Expressed Gene 14 Protein; NRPN; PRSS19; TADG14; UNQ283/PRO322) (PE); anti-KLK8 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human KLK8.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 915

• Applicable Applications for anti-KLK8 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human KLK8, aa1-260 (NP_009127.1).
• Immunogen Sequence: MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(KLK8 rabbit polyclonal antibody. Western Blot analysis of KLK8 expression in human kidney.)

Western Blot (WB)

(Western Blot analysis of KLK8 expression in transfected 293T cell line by KLK8 polyclonal antibody. Lane 1: KLK8 transfected lysate (28.0kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-KLK8 antibody

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer.

Product Categories/Family for anti-KLK8 antibody

Antibodies; Kallikrein

NCBI and Uniprot Product Information

• NCBI GI #: 1677498692
• NCBI GeneID: 11202
• NCBI Accession #: NM_007196.4
• NCBI GenBank Nucleotide #: NM_007196
• NCBI Official Full Name: Homo sapiens kallikrein related peptidase 8 (KLK8), transcript variant 1, mRNA
• NCBI Official Synonym Full Names: kallikrein related peptidase 8
• NCBI Official Symbol: KLK8
• NCBI Official Synonym Symbols: NP; HNP; NRPN; PRSS19; TADG14
• NCBI Protein Information: kallikrein-8
• Protein Family: Kallikrein

NCBI Description

Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]