CD86 recombinant protein

CD86 Recombinant Protein

Cat. Num. AAA3003720

• Gene Names: CD86; B70; B7-2; B7.2; LAB72; CD28LG2
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Synonyms: CD86; CD86 Recombinant Protein; CD86 recombinant protein

• Host: E Coli
• Purity/Purification: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is >85% (by SDS-PAGE).
• Form/Format: PBS, 4M Urea, PH7.4
• Concentration: >=0.5mg/ml (varies by lot)
• Sequence: APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIP

• Tag: His-tag in C-terminal
• Expression Vector: pet-22b(+)
• BP: 684
• Restriction Site: NdeI-XhoI
• Preparation and Storage: Store at 4 degee C for short term. Aliquot and store at -20 degee C long term. Avoid freeze-thaw cycles.

Testing Data

()

Related Product Information for CD86 recombinant protein

Background: CD80 (B7-1, BB1) and CD86 (B7-2, B70) are members of the B7 family of cell surface ligands that regulate T cell activation and immune responses. CD80 is expressed on activated antigen presenting cells, including dendritic cells, B cells, monocytes, and macrophages. CD86 is expressed on resting monocytes, dendritic cells, activated B lymphocytes, and can be further upregulated in the presence of inflammation. CD80 and CD86 are ligands for CD28, which functions as a T cell costimulatory receptor. Interaction of CD28 with CD80 or CD86 provides the second signal required for naïve T cell activation, T cell proliferation, and acquisition of effector functions. Alternatively, CD80 and CD86 also act as ligands to CTLA-4, which results in the downregulation of T cell activity.

NCBI and Uniprot Product Information

• NCBI GI #: 317373339
• NCBI GeneID: 942
• UniProt Accession #: P42081; Q13655; Q6FHB1; Q6GTS4; Q7M4L5; A0N0P0; B7Z2F3; B7Z702; E7ETN5; E9PC27
• Molecular Weight: 329
• NCBI Official Full Name: T-lymphocyte activation antigen CD86
• NCBI Official Synonym Full Names: CD86 molecule
• NCBI Official Symbol: CD86
• NCBI Official Synonym Symbols: B70; B7-2; B7.2; LAB72; CD28LG2
• NCBI Protein Information: T-lymphocyte activation antigen CD86; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen)
• UniProt Protein Name: T-lymphocyte activation antigen CD86
• Protein Family: T-lymphocyte activation antigen
• UniProt Gene Name: CD86
• UniProt Synonym Gene Names: CD28LG2
• UniProt Entry Name: CD86_HUMAN

NCBI Description

This gene encodes a type I membrane protein that is a member of the immunoglobulin superfamily. This protein is expressed by antigen-presenting cells, and it is the ligand for two proteins at the cell surface of T cells, CD28 antigen and cytotoxic T-lymphocyte-associated protein 4. Binding of this protein with CD28 antigen is a costimulatory signal for activation of the T-cell. Binding of this protein with cytotoxic T-lymphocyte-associated protein 4 negatively regulates T-cell activation and diminishes the immune response. Alternative splicing results in several transcript variants encoding different isoforms.[provided by RefSeq, May 2011]

Uniprot Description

CD86: Receptor involved in the costimulatory signal essential for T-lymphocyte proliferation and interleukin-2 production, by binding CD28 or CTLA-4. May play a critical role in the early events of T-cell activation and costimulation of naive T-cells, such as deciding between immunity and anergy that is made by T- cells within 24 hours after activation. Isoform 2 interferes with the formation of CD86 clusters, and thus acts as a negative regulator of T-cell activation. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 3q21

Cellular Component: cell surface; intracellular membrane-bound organelle; plasma membrane; integral to membrane; external side of plasma membrane

Molecular Function: protein binding; coreceptor activity; receptor activity; receptor binding

Biological Process: positive regulation of lymphotoxin A biosynthetic process; negative regulation of T cell anergy; T cell activation; viral reproduction; nerve growth factor receptor signaling pathway; positive regulation of transcription, DNA-dependent; positive regulation of interleukin-2 biosynthetic process; myeloid dendritic cell differentiation; positive regulation of activated T cell proliferation; positive regulation of interleukin-4 biosynthetic process; positive regulation of T-helper 2 cell differentiation; cell-cell signaling; T cell proliferation during immune response; positive regulation of cell proliferation; response to yeast; defense response to virus; aging; response to drug; epidermal growth factor receptor signaling pathway; fibroblast growth factor receptor signaling pathway; phosphoinositide-mediated signaling; B cell activation; T cell costimulation; toll-like receptor signaling pathway; innate immune response; immune response