Immunohistochemistry (IHC)
(Human Intestine)
Rabbit KLHL13 Polyclonal Antibody | anti-KLHL13 antibody
KLHL13 antibody - N-terminal region
Gene Names
KLHL13; BKLHD2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
KLHL13; Polyclonal Antibody; KLHL13 antibody - N-terminal region; anti-KLHL13 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KTSSPAIWKFPVPVLKTSRSTPLSPAYISLVEEEDQHMKLSLGGSEMGLS
Sequence Length
655
Applicable Applications for anti-KLHL13 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KLHL13
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Human Intestine)
Immunohistochemistry (IHC)
(Human Intestine)
Western Blot (WB)
(WB Suggested Anti-KLHL13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-KLHL13 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-KLHL13 antibody
This is a rabbit polyclonal antibody against KLHL13. It was validated on Western Blot and immunohistochemistry
Target Description: KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Target Description: KLHL13 contains 6 Kelch repeats and 1 BTB (POZ) domain. The function of this protein remains unknown
Product Categories/Family for anti-KLHL13 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
74kDa
NCBI Official Full Name
kelch-like protein 13 isoform a
NCBI Official Synonym Full Names
kelch like family member 13
NCBI Official Symbol
KLHL13
NCBI Official Synonym Symbols
BKLHD2
NCBI Protein Information
kelch-like protein 13
UniProt Protein Name
Kelch-like protein 13
Protein Family
UniProt Gene Name
KLHL13
UniProt Synonym Gene Names
BKLHD2; KIAA1309
UniProt Entry Name
KLH13_HUMAN
NCBI Description
This gene encodes a BTB and kelch domain containing protein and belongs to the kelch repeat domain containing superfamily of proteins. The encoded protein functions as an adaptor protein that complexes with Cullin 3 and other proteins to form the Cullin 3-based E3 ubiquitin-protein ligase complex. This complex is necessary for proper chromosome segregation and completion of cytokinesis. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]
Similar Products
Product Notes
The KLHL13 klhl13 (Catalog #AAA3202199) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KLHL13 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KLHL13 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the KLHL13 klhl13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KTSSPAIWKF PVPVLKTSRS TPLSPAYISL VEEEDQHMKL SLGGSEMGLS. It is sometimes possible for the material contained within the vial of "KLHL13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
