Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of KIR2DL4 expression in transfected 293T cell line by KIR2DL4 polyclonal antibody. Lane 1: KIR2DL4 transfected lysate (41.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human KIR2DL4 Polyclonal Antibody | anti-KIR2DL4 antibody

KIR2DL4 (CD158D, KIR103AS, Killer Cell Immunoglobulin-like Receptor 2DL4, CD158 Antigen-like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d) (AP)

Gene Names
KIR2DL4; G9P; CD158D; KIR103; KIR-2DL4; KIR103AS; KIR-103AS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KIR2DL4; Polyclonal Antibody; KIR2DL4 (CD158D; KIR103AS; Killer Cell Immunoglobulin-like Receptor 2DL4; CD158 Antigen-like Family Member D; G9P; Killer Cell Inhibitory Receptor 103AS; MHC Class I NK Cell Receptor KIR103AS; CD158d) (AP); anti-KIR2DL4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human KIR2DL4.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
377
Applicable Applications for anti-KIR2DL4 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human KIR2DL4, aa1-377 (AAH41611.1).
Immunogen Sequence
MSMSPTVIILACLGFFLDQSVWAHVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRTGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDASDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHAVIRYSVAIILFTILPFFLLHRWCSKKKNAAVMNQEPAGHRTVNREDSDEQDPQEVTYAQLDHCIFTQRKITGPSQRSKRPSTDTSVCIELPNAEPRALSPAHEHHSQALMGSSRETTALSQTQLASSNVPAAGI
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of KIR2DL4 expression in transfected 293T cell line by KIR2DL4 polyclonal antibody. Lane 1: KIR2DL4 transfected lysate (41.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KIR2DL4 expression in transfected 293T cell line by KIR2DL4 polyclonal antibody. Lane 1: KIR2DL4 transfected lysate (41.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-KIR2DL4 antibody
KIR2DL4 is killer cell immunoglobulin-like receptors (KIRs) which are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC).
Product Categories/Family for anti-KIR2DL4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
NCBI Official Full Name
KIR2DL4 protein
NCBI Official Synonym Full Names
killer cell immunoglobulin like receptor, two Ig domains and long cytoplasmic tail 4
NCBI Official Symbol
KIR2DL4
NCBI Official Synonym Symbols
G9P; CD158D; KIR103; KIR-2DL4; KIR103AS; KIR-103AS
NCBI Protein Information
killer cell immunoglobulin-like receptor 2DL4

NCBI Description

Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternate alleles of this gene are represented on multiple alternate reference loci (ALT_REF_LOCs). Alternative splicing results in multiple transcript variants, some of which may not be annotated on the primary reference assembly. [provided by RefSeq, Jul 2016]

Research Articles on KIR2DL4

Similar Products

Product Notes

The KIR2DL4 (Catalog #AAA6383586) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIR2DL4 (CD158D, KIR103AS, Killer Cell Immunoglobulin-like Receptor 2DL4, CD158 Antigen-like Family Member D, G9P, Killer Cell Inhibitory Receptor 103AS, MHC Class I NK Cell Receptor KIR103AS, CD158d) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIR2DL4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KIR2DL4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIR2DL4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.