Western Blot (WB)
(WB Suggested Anti-IL22RA2 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Rabbit anti-Dog, Human IL22RA2 Polyclonal Antibody | anti-IL22RA2 antibody
IL22RA2 Antibody - C-terminal region
Gene Names
IL22RA2; CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2
Reactivity
Dog, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL22RA2; Polyclonal Antibody; IL22RA2 Antibody - C-terminal region; anti-IL22RA2 antibody
Host
Rabbit
Reactivity
Dog, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: NITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKE
Sequence Length
263
Applicable Applications for anti-IL22RA2 antibody
Western Blot (WB)
Homology
Dog: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IL22RA2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IL22RA2 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Western Blot (WB)
(WB Suggested Anti-IL22RA2 AntibodyTitration: 1.0 ug/mlPositive Control: RPMI-8226 Whole Cell)
Related Product Information for anti-IL22RA2 antibody
This is a rabbit polyclonal antibody against IL22RA2. It was validated on Western Blot
Target Description: The protein encoded by this gene is a soluble class II cytokine receptor. This protein has been shown to specifically bind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22 activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Target Description: The protein encoded by this gene is a soluble class II cytokine receptor. This protein has been shown to specifically bind to interleukin 22 (IL22), block the interaction of IL22 with its cell surface receptor, and thus inhibit IL22 activity. This protein functions as an IL22 antagonist, and may be important in the regulation of inflammatory response. Three alternatively spliced transcript variants encoding distinct isoforms have been described.
Product Categories/Family for anti-IL22RA2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
interleukin-22 receptor subunit alpha-2 isoform 1
NCBI Official Synonym Full Names
interleukin 22 receptor subunit alpha 2
NCBI Official Symbol
IL22RA2
NCBI Official Synonym Symbols
CRF2X; CRF2-10; CRF2-S1; IL-22BP; IL-22RA2; ZCYTOR16; IL-22R-alpha-2
NCBI Protein Information
interleukin-22 receptor subunit alpha-2
UniProt Protein Name
Interleukin-22 receptor subunit alpha-2
Protein Family
UniProt Gene Name
IL22RA2
UniProt Synonym Gene Names
IL-22 receptor subunit alpha-2; IL-22R-alpha-2; IL-22RA2; CRF2-10; CRF2-S1; IL-22BP; IL22BP
UniProt Entry Name
I22R2_HUMAN
NCBI Description
This gene encodes a member of the class II cytokine receptor family. The encoded soluble protein specifically binds to and inhibits interleukin 22 activity by blocking the interaction of interleukin 22 with its cell surface receptor. The encoded protein may be important in the regulation of inflammatory response, and has been implicated in the regulation of tumorigenesis in the colon. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2013]
Research Articles on IL22RA2
Similar Products
Product Notes
The IL22RA2 il22ra2 (Catalog #AAA3216829) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL22RA2 Antibody - C-terminal region reacts with Dog, Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL22RA2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL22RA2 il22ra2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NITQVNGSLL VILHAPNLPY RYQKEKNVSI EDYYELLYRV FIINNSLEKE. It is sometimes possible for the material contained within the vial of "IL22RA2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
