Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KIF2CSample Tissue: Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KIF2C Polyclonal Antibody | anti-KIF2C antibody

KIF2C Antibody - middle region

Gene Names
KIF2C; MCAK; CT139; KNSL6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIF2C; Polyclonal Antibody; KIF2C Antibody - middle region; anti-KIF2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 16% sucrose.
Sequence
Synthetic peptide located within the following region: SCEYTLNTLRYADRVKELSPHSGPSGEQLIQMETEEMEACSNGALIPGNL
Sequence Length
725
Applicable Applications for anti-KIF2C antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KIF2C
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KIF2CSample Tissue: Ovary Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KIF2CSample Tissue: Ovary Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KIF2C antibody
This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-KIF2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79 kDa
NCBI Official Full Name
kinesin-like protein KIF2C isoform 1
NCBI Official Synonym Full Names
kinesin family member 2C
NCBI Official Symbol
KIF2C
NCBI Official Synonym Symbols
MCAK; CT139; KNSL6
NCBI Protein Information
kinesin-like protein KIF2C
UniProt Protein Name
Kinesin-like protein KIF2C
Protein Family
UniProt Gene Name
KIF2C
UniProt Synonym Gene Names
KNSL6; MCAK
UniProt Entry Name
KIF2C_HUMAN

NCBI Description

This gene encodes a kinesin-like protein that functions as a microtubule-dependent molecular motor. The encoded protein can depolymerize microtubules at the plus end, thereby promoting mitotic chromosome segregation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]

Uniprot Description

KIF2C: In complex with KIF18B, constitutes the major microtubule plus-end depolymerizing activity in mitotic cells. Regulates the turnover of microtubules at the kinetochore and functions in chromosome segregation during mitosis. Belongs to the kinesin-like protein family. MCAK/KIF2 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cancer Testis Antigen (CTA); Microtubule-binding; Motor; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: kinetochore; microtubule cytoskeleton; kinesin complex; membrane; cytoplasmic microtubule; cytosol; nucleus; chromosome, pericentric region

Molecular Function: centromeric DNA binding; microtubule plus-end binding; protein binding; ATPase activity; microtubule motor activity; ATP binding

Biological Process: mitosis; cell proliferation; cell division; metabolic process; antigen processing and presentation of exogenous peptide antigen via MHC class II; microtubule depolymerization; regulation of chromosome segregation; mitotic cell cycle; blood coagulation; mitotic metaphase plate congression; microtubule-based movement; establishment and/or maintenance of microtubule cytoskeleton polarity

Research Articles on KIF2C

Similar Products

Product Notes

The KIF2C kif2c (Catalog #AAA3219764) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF2C Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KIF2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KIF2C kif2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SCEYTLNTLR YADRVKELSP HSGPSGEQLI QMETEEMEAC SNGALIPGNL. It is sometimes possible for the material contained within the vial of "KIF2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.