Western Blot (WB)
(Host: MouseTarget Name: KIF23Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Rabbit KIF23 Polyclonal Antibody | anti-KIF23 antibody
KIF23 antibody - N-terminal region
Gene Names
KIF23; CHO1; KNSL5; MKLP1; MKLP-1
Reactivity
Cow, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
KIF23; Polyclonal Antibody; KIF23 antibody - N-terminal region; anti-KIF23 antibody
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MKSARAKTPRKPTVKKGSQTNLKDPVGVYCRVRPLGFPDQECCIEVINNT
Sequence Length
856
Applicable Applications for anti-KIF23 antibody
Western Blot (WB)
Homology
Cow: 85%; Horse: 85%; Human: 100%; Mouse: 85%; Rabbit: 92%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human KIF23
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: MouseTarget Name: KIF23Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: MouseTarget Name: KIF23Sample Tissue: Mouse TestisAntibody Dilution: 1ug/ml)
Western Blot (WB)
(WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-KIF23 Antibody Titration: 1.25ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-KIF23 antibody
This is a rabbit polyclonal antibody against KIF23. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Target Description: KIF23 is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in two transcript variants encoding two different isoforms.
Product Categories/Family for anti-KIF23 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
98kDa
NCBI Official Full Name
kinesin-like protein KIF23 isoform 2
NCBI Official Synonym Full Names
kinesin family member 23
NCBI Official Symbol
KIF23
NCBI Official Synonym Symbols
CHO1; KNSL5; MKLP1; MKLP-1
NCBI Protein Information
kinesin-like protein KIF23
UniProt Protein Name
Kinesin-like protein KIF23
Protein Family
UniProt Gene Name
KIF23
UniProt Synonym Gene Names
KNSL5; MKLP1
NCBI Description
The protein encoded by this gene is a member of kinesin-like protein family. This family includes microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. This protein has been shown to cross-bridge antiparallel microtubules and drive microtubule movement in vitro. Alternate splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Uniprot Description
Component of the centralspindlin complex that serves as a microtubule-dependent and Rho-mediated signaling required for the myosin contractile ring formation during the cell cycle cytokinesis. Essential for cytokinesis in Rho-mediated signaling. Required for the localization of ECT2 to the central spindle. Plus-end-directed motor enzyme that moves antiparallel microtubules in vitro.
Research Articles on KIF23
Similar Products
Product Notes
The KIF23 kif23 (Catalog #AAA3201806) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIF23 antibody - N-terminal region reacts with Cow, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIF23 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KIF23 kif23 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MKSARAKTPR KPTVKKGSQT NLKDPVGVYC RVRPLGFPDQ ECCIEVINNT. It is sometimes possible for the material contained within the vial of "KIF23, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
