Rabbit anti-Mouse KIAA1324 Polyclonal Antibody | anti-KIAA1324 antibody
KIAA1324 Polyclonal Antibody
Gene Names
KIAA1324; EIG121
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
KIAA1324; Polyclonal Antibody; KIAA1324 Polyclonal Antibody; EIG121; anti-KIAA1324 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
TGPELHACKESEYHYEYTACDSTGSRWRVAVPHTPGLCTSLPDPVKGTECSFSCNAGEFLDMKDQSCKPCAEGRYSLGTGIRFDEWDELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSIIFEFFVQNDQCQPNADDSRWMKTTEKGWEFHSVELNRGNNVLYWRTTAFSVWTKVPKPVLTQLMYKWAKPKICSEDLEGAVKLPASGVKTHCPPCN
Sequence Length
926
Applicable Applications for anti-KIAA1324 antibody
Western Blot (WB)
Application Notes
WB: 1:200 - 1:2000
Immunogen
Recombinant protein of human KIAA1324
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cell membrane, Golgi apparatus, Late endosome membrane, Lysosome membrane, Single-pass membrane protein, Single-pass type I membrane protein, trans-Golgi network membrane
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Related Product Information for anti-KIAA1324 antibody
Expression of this gene is induced by estrogen and the encoded protein has been characterized as a transmembrane protein. The encoded protein has been found in to correlate with survival in certain carcinomas (PMID: 21102415) and may be important for cellular response to stress (PMID: 21072319). Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-KIAA1324 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
101kDa/109kDa/110kDa/111kDa
NCBI Official Full Name
UPF0577 protein KIAA1324 isoform 2
NCBI Official Synonym Full Names
KIAA1324
NCBI Official Symbol
KIAA1324
NCBI Official Synonym Symbols
EIG121
NCBI Protein Information
UPF0577 protein KIAA1324
UniProt Protein Name
UPF0577 protein KIAA1324
Protein Family
UniProt Gene Name
KIAA1324
UniProt Synonym Gene Names
EIG121
NCBI Description
Expression of this gene is induced by estrogen and the encoded protein has been characterized as a transmembrane protein. The encoded protein has been found in to correlate with survival in certain carcinomas (PMID: 21102415) and may be important for cellular response to stress (PMID: 21072319). Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2012]
Uniprot Description
May protect cells from cell death by inducing cytosolic vacuolization and upregulating the autophagy pathway.
Research Articles on KIAA1324
Similar Products
Product Notes
The KIAA1324 kiaa1324 (Catalog #AAA9135476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIAA1324 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KIAA1324 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:200 - 1:2000. Researchers should empirically determine the suitability of the KIAA1324 kiaa1324 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: TGPELHACKE SEYHYEYTAC DSTGSRWRVA VPHTPGLCTS LPDPVKGTEC SFSCNAGEFL DMKDQSCKPC AEGRYSLGTG IRFDEWDELP HGFASLSANM ELDDSAAEST GNCTSSKWVP RGDYIASNTD ECTATLMYAV NLKQSGTVNF EYYYPDSSII FEFFVQNDQC QPNADDSRWM KTTEKGWEFH SVELNRGNNV LYWRTTAFSV WTKVPKPVLT QLMYKWAKPK ICSEDLEGAV KLPASGVKTH CPPCN. It is sometimes possible for the material contained within the vial of "KIAA1324, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
