Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIAA1191 antibody (MBS5301818) used at 1 ug/ml to detect target protein.)

Rabbit KIAA1191 Polyclonal Antibody | anti-KIAA1191 antibody

KIAA1191 antibody

Gene Names
KIAA1191; p60MONOX
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIAA1191; Polyclonal Antibody; KIAA1191 antibody; Polyclonal KIAA1191; Anti-KIAA1191; KIAA-1191; KIAA 1191; Kiaa1191; FLJ21022; anti-KIAA1191 antibody
Ordering
For Research Use Only!
Host
Rabbit
Clonality
Polyclonal
Specificity
KIAA1191 antibody was raised against the middle region of KIAA1191
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA1191 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
305
Applicable Applications for anti-KIAA1191 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
The function of KIAA1191 protein is not widely studied, and is yet to be elucidated fully.
Cross-Reactivity
Human
Immunogen
KIAA1191 antibody was raised using the middle region of KIAA1191 corresponding to a region with amino acids TPHSSPKQRPRGWFTSGSSTALPGPNPSTMDSGSGDKDRNLSDKWSLFGP
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KIAA1191 antibody (MBS5301818) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KIAA1191 antibody (MBS5301818) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KIAA1191 antibody
Rabbit polyclonal KIAA1191 antibody raised against the middle region of KIAA1191
Product Categories/Family for anti-KIAA1191 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
33 kDa (MW of target protein)
NCBI Official Full Name
KIAA1191
NCBI Official Synonym Full Names
KIAA1191
NCBI Official Symbol
KIAA1191
NCBI Official Synonym Symbols
p60MONOX
NCBI Protein Information
putative monooxygenase p33MONOX
UniProt Protein Name
Putative monooxygenase p33MONOX
UniProt Gene Name
KIAA1191
UniProt Synonym Gene Names
P33MONOX
UniProt Entry Name
P33MX_HUMAN

Uniprot Description

KIAA1191: Potential NADPH-dependent oxidoreductase. May be involved in the regulation of neuronal survival, differentiation and axonal outgrowth. Belongs to the P33MONOX family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 1.-.-.-

Chromosomal Location of Human Ortholog: 5q35.2

Cellular Component: cytoplasm

Molecular Function: oxidoreductase activity

Research Articles on KIAA1191

Similar Products

Product Notes

The KIAA1191 kiaa1191 (Catalog #AAA5301818) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's KIAA1191 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KIAA1191 kiaa1191 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA1191, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.