Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (KIAA0157 antibody (MBS5301024) used at 1 ug/ml to detect target protein.)

Rabbit KIAA0157 Polyclonal Antibody | anti-KIAA0157 antibody

KIAA0157 antibody

Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
KIAA0157; Polyclonal Antibody; KIAA0157 antibody; Polyclonal KIAA0157; Anti-KIAA0157; KIAA0 157; KIAA0-157; ABRO1; FLJ22338; anti-KIAA0157 antibody
Ordering
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Specificity
KIAA0157 antibody was raised against the middle region of Kiaa0157
Purity/Purification
Affinity purified
Form/Format
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of KIAA0157 antibody in PBS
Concentration
1 mg/ml (varies by lot)
Sequence Length
419
Applicable Applications for anti-KIAA0157 antibody
Western Blot (WB)
Application Notes
WB: 1 ug/ml
Biological Significance
KIAA0157 is a component of the BRISC complex, a multiprotein complex that specifically cleaves 'Lys-63'-linked ubiquitin. It may act as a central scaffold protein that assembles the various components of the BRISC complex.
Cross-Reactivity
Human,Mouse,Rat
Immunogen
KIAA0157 antibody was raised using the middle region of Kiaa0157 corresponding to a region with amino acids GDSGEDSDDSDYENLIDPTEPSNSEYSHSKDSRPMAHPDEDPRNTQTSQI
Preparation and Storage
Store at 2-8 degree C for short periods. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Western Blot (WB)

(KIAA0157 antibody (MBS5301024) used at 1 ug/ml to detect target protein.)

Western Blot (WB) (KIAA0157 antibody (MBS5301024) used at 1 ug/ml to detect target protein.)
Related Product Information for anti-KIAA0157 antibody
Rabbit polyclonal KIAA0157 antibody raised against the middle region of Kiaa0157
Product Categories/Family for anti-KIAA0157 antibody

NCBI and Uniprot Product Information

NCBI GI #
Molecular Weight
47 kDa (MW of target protein)
NCBI Official Full Name
KIAA0157, partial
UniProt Protein Name
BRISC complex subunit Abro1
UniProt Gene Name
FAM175B
UniProt Synonym Gene Names
ABRO1; KIAA0157
UniProt Entry Name
F175B_HUMAN

Uniprot Description

FAM175B: a protein of unknown function.

Protein type: Ubiquitin conjugating system

Chromosomal Location of Human Ortholog: 10q26.13

Cellular Component: cytoplasm

Molecular Function: polyubiquitin binding

Similar Products

Product Notes

The KIAA0157 fam175b (Catalog #AAA5301024) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KIAA0157 antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KIAA0157 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1 ug/ml. Researchers should empirically determine the suitability of the KIAA0157 fam175b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KIAA0157, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.