Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: KDM4ASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human KDM4A Polyclonal Antibody | anti-KDM4A antibody

KDM4A Antibody - middle region

Gene Names
KDM4A; JMJD2; JHDM3A; JMJD2A; TDRD14A
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
KDM4A; Polyclonal Antibody; KDM4A Antibody - middle region; anti-KDM4A antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AEVADEYMFSLEENKKSKGRRQPLSKLPRHHPLVLQECVSDDETSEQLTP
Sequence Length
481
Applicable Applications for anti-KDM4A antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human KDM4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: KDM4ASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: KDM4ASample Tissue: Human HT1080 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KDM4A antibody
This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor.
Product Categories/Family for anti-KDM4A antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
52 kDa
NCBI Official Full Name
lysine-specific demethylase 4A
NCBI Official Synonym Full Names
lysine demethylase 4A
NCBI Official Symbol
KDM4A
NCBI Official Synonym Symbols
JMJD2; JHDM3A; JMJD2A; TDRD14A
NCBI Protein Information
lysine-specific demethylase 4A
UniProt Protein Name
Lysine-specific demethylase 4A
UniProt Gene Name
KDM4A
UniProt Synonym Gene Names
JHDM3A; JMJD2; JMJD2A; KIAA0677
UniProt Entry Name
KDM4A_HUMAN

NCBI Description

This gene is a member of the Jumonji domain 2 (JMJD2) family and encodes a protein containing a JmjN domain, a JmjC domain, a JD2H domain, two TUDOR domains, and two PHD-type zinc fingers. This nuclear protein functions as a trimethylation-specific demethylase, converting specific trimethylated histone residues to the dimethylated form, and as a transcriptional repressor. [provided by RefSeq, Apr 2009]

Uniprot Description

JMJD2A: Histone demethylase that specifically demethylates 'Lys- 9' and 'Lys-36' residues of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-4', H3 'Lys-27' nor H4 'Lys-20'. Demethylates trimethylated H3 'Lys-9' and H3 'Lys-36' residue, while it has no activity on mono- and dimethylated residues. Demethylation of Lys residue generates formaldehyde and succinate. Participates in transcriptional repression of ASCL2 and E2F-responsive promoters via the recruitment of histone deacetylases and NCOR1, respectively. Interacts with histone deacetylase proteins HDAC1, HDAC2 and HDAC3. Interacts with RB and NCOR1. Interacts with HTLV-1 Tax protein. Ubiquitous. Belongs to the JHDM3 histone demethylase family.

Protein type: Transcription, coactivator/corepressor; Demethylase; EC 1.14.11.-; Oxidoreductase

Chromosomal Location of Human Ortholog: 1p34.1

Cellular Component: nucleoplasm; cytoplasm; nucleolus; nucleus

Molecular Function: protein binding; zinc ion binding; ubiquitin protein ligase binding; histone demethylase activity (H3-K36 specific); methylated histone residue binding

Biological Process: cardiac muscle hypertrophy; histone demethylation; establishment and/or maintenance of chromatin architecture; transcription, DNA-dependent; viral reproduction; negative regulation of transcription, DNA-dependent

Research Articles on KDM4A

Similar Products

Product Notes

The KDM4A kdm4a (Catalog #AAA3223478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KDM4A Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KDM4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KDM4A kdm4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AEVADEYMFS LEENKKSKGR RQPLSKLPRH HPLVLQECVS DDETSEQLTP. It is sometimes possible for the material contained within the vial of "KDM4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.