Western Blot (WB)
(Host: RabbitTarget Name: KCNS2Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Mouse KCNS2 Polyclonal Antibody | anti-KCNS2 antibody
KCNS2 Antibody - middle region
Gene Names
Kcns2; Kv9.2; E130006J24Rik
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity purified
Synonyms
KCNS2; Polyclonal Antibody; KCNS2 Antibody - middle region; anti-KCNS2 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GINEFFIDSCCSYSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDA
Sequence Length
477
Applicable Applications for anti-KCNS2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse KCNS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: KCNS2Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: KCNS2Sample Tissue: Mouse Skeletal Muscle lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-KCNS2 antibody
Potassium channel subunit that does not form functional channels by itself. Can form functional heterotetrameric channels with KCNB1 and KCNB2; modulates the delayed rectifier voltage-gated potassium channel activation and deactivation rates of KCNB1 and KCNB2.
Product Categories/Family for anti-KCNS2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54 kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily S member 2
NCBI Official Synonym Full Names
K+ voltage-gated channel, subfamily S, 2
NCBI Official Symbol
Kcns2
NCBI Official Synonym Symbols
Kv9.2; E130006J24Rik
NCBI Protein Information
potassium voltage-gated channel subfamily S member 2
UniProt Protein Name
Potassium voltage-gated channel subfamily S member 2
Protein Family
UniProt Gene Name
Kcns2
UniProt Entry Name
KCNS2_MOUSE
Uniprot Description
Kv9.2: Potassium channel subunit. Modulates channel activity and reduces the ion flow. Belongs to the potassium channel family. S (TC 1.A.1.2) subfamily. Kv9.2/KCNS2 sub-subfamily.
Protein type: Membrane protein, multi-pass; Membrane protein, integral
Cellular Component: voltage-gated potassium channel complex; membrane; integral to membrane; plasma membrane
Molecular Function: voltage-gated potassium channel activity; potassium channel activity; delayed rectifier potassium channel activity; ion channel activity; voltage-gated ion channel activity
Biological Process: transport; ion transport; transmembrane transport; protein homooligomerization; potassium ion transport
Similar Products
Product Notes
The KCNS2 kcns2 (Catalog #AAA3223848) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNS2 Antibody - middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCNS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KCNS2 kcns2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GINEFFIDSC CSYSYHGRKV EPEQEKWDEQ SDQESTTSSF DEILAFYNDA. It is sometimes possible for the material contained within the vial of "KCNS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
