Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-KCND1 Polyclonal Antibody)

Rabbit KCND1 Polyclonal Antibody | anti-KCND1 antibody

KCND1 Polyclonal Antibody

Gene Names
KCND1; KV4.1
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
KCND1; Polyclonal Antibody; KCND1 Polyclonal Antibody; KV4.1; potassium voltage-gated channel subfamily D member 1; anti-KCND1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.83 mg/ml (varies by lot)
Sequence Length
647
Applicable Applications for anti-KCND1 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 488-647 of human KCND1 (NP_004970.3).
Immunogen Sequence
TTCHEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELDMLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNSSLGTPCLFPETVKISSL
Positive Samples
U-87MG, 293T, BxPC-3, Mouse Brain, Mouse Pancreas, Mouse Heart, Rat Brain, Rat Pancreas, Rat Heart
Cellular Location
Cell Projection, Membrane, Multi-Pass Membrane Protein, Dendrite
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-KCND1 Polyclonal Antibody)

Western Blot (WB) (Western blot-KCND1 Polyclonal Antibody)
Related Product Information for anti-KCND1 antibody
This gene encodes a multipass membrane protein that comprises the pore subunit of the voltage-gated A-type potassium channel, which functions in the repolarization of membrane action potentials. Activity of voltage-gated potassium channels is important in a number of physiological processes, among them the regulation of neurotransmitter release, heart rate, insulin secretion, and smooth muscle contraction.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 28kDa; 71kDa
Observed: 71kDa
NCBI Official Full Name
potassium voltage-gated channel subfamily D member 1
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily D member 1
NCBI Official Symbol
KCND1
NCBI Official Synonym Symbols
KV4.1
NCBI Protein Information
potassium voltage-gated channel subfamily D member 1
UniProt Protein Name
Potassium voltage-gated channel subfamily D member 1
UniProt Gene Name
KCND1
UniProt Entry Name
KCND1_HUMAN

NCBI Description

This gene encodes a multipass membrane protein that comprises the pore subunit of the voltage-gated A-type potassium channel, which functions in the repolarization of membrane action potentials. Activity of voltage-gated potassium channels is important in a number of physiological processes, among them the regulation of neurotransmitter release, heart rate, insulin secretion, and smooth muscle contraction. [provided by RefSeq, Aug 2013]

Uniprot Description

KCND1: Pore-forming (alpha) subunit of voltage-gated rapidly inactivating A-type potassium channels. May contribute to I(To) current in heart and I(Sa) current in neurons. Channel properties are modulated by interactions with other alpha subunits and with regulatory subunits. Belongs to the potassium channel family. D (Shal) (TC 1.A.1.2) subfamily. Kv4.1/KCND1 sub-subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: voltage-gated potassium channel complex; cell soma; dendrite; integral to membrane; plasma membrane

Molecular Function: delayed rectifier potassium channel activity; metal ion binding

Biological Process: synaptic transmission; protein homooligomerization

Research Articles on KCND1

Similar Products

Product Notes

The KCND1 kcnd1 (Catalog #AAA9140424) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCND1 Polyclonal Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KCND1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the KCND1 kcnd1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KCND1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.