Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using KCNAB3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Rabbit anti-Mouse KCNAB3 Polyclonal Antibody | anti-KCNAB3 antibody
KCNAB3 Polyclonal Antibody
Gene Names
KCNAB3; AKR6A9; KCNA3B; KCNA3.1B; KV-BETA-3
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
KCNAB3; Polyclonal Antibody; KCNAB3 Polyclonal Antibody; AKR6A9; KCNA3.1B; KCNA3B; KV-BETA-3; anti-KCNAB3 antibody
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YPLACGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQLGCTVAQLAIAWCLRSEGVSSVLLGVSSAEQLIEHLGALQVLSQLTPQTVMEIDGLLGNKPHSKK
Sequence Length
404
Applicable Applications for anti-KCNAB3 antibody
Western Blot (WB)
Application Notes
WB: 1:500 - 1:2000
Immunogen
Recombinant protein of human KCNAB3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Cytoplasm
Positive Samples
Mouse brain, Mouse kidney, Mouse lung, Mouse heart
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using KCNAB3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Western Blot (WB)
(Western blot analysis of extracts of various cell lines, using KCNAB3 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (MBS128200) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.)
Related Product Information for anti-KCNAB3 antibody
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodimer with the potassium voltage-gated channel, shaker-related subfamily, member 5 gene product and regulates the activity of the alpha subunit.
Product Categories/Family for anti-KCNAB3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
Calculated: 43kDa
Observed: 44kDa
Observed: 44kDa
NCBI Official Full Name
voltage-gated potassium channel subunit beta-3
NCBI Official Synonym Full Names
potassium voltage-gated channel subfamily A regulatory beta subunit 3
NCBI Official Symbol
KCNAB3
NCBI Official Synonym Symbols
AKR6A9; KCNA3B; KCNA3.1B; KV-BETA-3
NCBI Protein Information
voltage-gated potassium channel subunit beta-3
UniProt Protein Name
Voltage-gated potassium channel subunit beta-3
Protein Family
UniProt Gene Name
KCNAB3
UniProt Synonym Gene Names
KCNA3B
NCBI Description
This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functional Kv-alpha subunits. The encoded protein forms a heterodimer with the potassium voltage-gated channel, shaker-related subfamily, member 5 gene product and regulates the activity of the alpha subunit. [provided by RefSeq, May 2012]
Uniprot Description
Accessory potassium channel protein which modulates the activity of the pore-forming alpha subunit. Alters the functional properties of Kv1.5.
Similar Products
Product Notes
The KCNAB3 kcnab3 (Catalog #AAA9134813) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KCNAB3 Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's KCNAB3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500 - 1:2000. Researchers should empirically determine the suitability of the KCNAB3 kcnab3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YPLACGLITS KYDGRVPDTC RASIKGYQWL KDKVQSEDGK KQQAKVMDLL PVAHQLGCTV AQLAIAWCLR SEGVSSVLLG VSSAEQLIEH LGALQVLSQL TPQTVMEIDG LLGNKPHSKK. It is sometimes possible for the material contained within the vial of "KCNAB3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
