Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-KBTBD10 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Rabbit KBTBD10 Polyclonal Antibody | anti-KLHL41 antibody

KBTBD10 antibody - C-terminal region

Gene Names
KLHL41; Krp1; KBTBD10; SARCOSIN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
KBTBD10; Polyclonal Antibody; KBTBD10 antibody - C-terminal region; anti-KLHL41 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AGSLYAIGGFAMIQLESKEFAPTEVNDIWKYEDDKKEWAGMLKEIRYASG
Sequence Length
606
Applicable Applications for anti-KLHL41 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human KBTBD10
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-KBTBD10 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)

Western Blot (WB) (WB Suggested Anti-KBTBD10 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Human Muscle)
Related Product Information for anti-KLHL41 antibody
This is a rabbit polyclonal antibody against KBTBD10. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: KBTBD10 contains 1 BTB (POZ) domain and is required for pseudopod elongation in transformed cells. KBTBD10 mRNA is up-regulated by less than two folds in the heart in human patients with HCM.
Product Categories/Family for anti-KLHL41 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
kelch-like protein 41
NCBI Official Synonym Full Names
kelch like family member 41
NCBI Official Symbol
KLHL41
NCBI Official Synonym Symbols
Krp1; KBTBD10; SARCOSIN
NCBI Protein Information
kelch-like protein 41
UniProt Protein Name
Kelch-like protein 41
Protein Family
UniProt Gene Name
KLHL41
UniProt Synonym Gene Names
KBTBD10; KRP1
UniProt Entry Name
KLH41_HUMAN

NCBI Description

This gene is a member of the kelch-like family. The encoded protein contains a BACK domain, a BTB/POZ domain, and 5 Kelch repeats. This protein is thought to function in skeletal muscle development and maintenance. Mutations in this gene have been associated with nemaline myopathy (NM), a rare congenital muscle disorder. [provided by RefSeq, Mar 2015]

Uniprot Description

KBTBD10: Required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Contractile; Cell adhesion; Ubiquitin conjugating system; Cytoskeletal

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: ruffle; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; cytoskeleton; cytoplasm; plasma membrane; M band; pseudopodium; nucleus

Molecular Function: protein binding

Biological Process: myofibril assembly; striated muscle contraction; regulation of myoblast differentiation; protein ubiquitination; regulation of lateral pseudopodium formation

Disease: Nemaline Myopathy 9

Research Articles on KLHL41

Similar Products

Product Notes

The KLHL41 klhl41 (Catalog #AAA3204245) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The KBTBD10 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's KBTBD10 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the KLHL41 klhl41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGSLYAIGGF AMIQLESKEF APTEVNDIWK YEDDKKEWAG MLKEIRYASG. It is sometimes possible for the material contained within the vial of "KBTBD10, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.