Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human KBTBD10 Monoclonal Antibody | anti-KBTBD10 antibody

KBTBD10 (KRP1, Kelch Repeat and BTB Domain-containing Protein 10, Kel-like Protein 23, Kelch-related Protein 1, Sarcosin) (FITC)

Gene Names
KLHL41; Krp1; KBTBD10; SARCOSIN
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
KBTBD10; Monoclonal Antibody; KBTBD10 (KRP1; Kelch Repeat and BTB Domain-containing Protein 10; Kel-like Protein 23; Kelch-related Protein 1; Sarcosin) (FITC); anti-KBTBD10 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1H3
Specificity
Recognizes human KBTBD10.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
2460
Applicable Applications for anti-KBTBD10 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa205-304 from KBTBD10 (NP_006054) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
RTDKENRVKNLSEVFDCIRFRLMTEKYFKDHVEKDDIIKSNPDLQKKIKVLKDAFAGKLPEPSKNAAKTGAGEVNGDVGDEDLLPGYLNDIPRHGMFVKD
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of KBTBD10 expression in transfected 293T cell line by KBTBD10 monoclonal antibody. Lane 1: KBTBD10 transfected lysate (Predicted MW: 68kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of KBTBD10 expression in transfected 293T cell line by KBTBD10 monoclonal antibody. Lane 1: KBTBD10 transfected lysate (Predicted MW: 68kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged KBTBD10 is 0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged KBTBD10 is 0.03ng/ml as a capture antibody.)
Related Product Information for anti-KBTBD10 antibody
KBTBD10 is required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.
Product Categories/Family for anti-KBTBD10 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens kelch like family member 41 (KLHL41), mRNA
NCBI Official Synonym Full Names
kelch like family member 41
NCBI Official Symbol
KLHL41
NCBI Official Synonym Symbols
Krp1; KBTBD10; SARCOSIN
NCBI Protein Information
kelch-like protein 41
UniProt Protein Name
Kelch-like protein 41
UniProt Gene Name
KLHL41
UniProt Synonym Gene Names
KBTBD10; KRP1
UniProt Entry Name
KLH41_HUMAN

NCBI Description

This gene is a member of the kelch-like family. The encoded protein contains a BACK domain, a BTB/POZ domain, and 5 Kelch repeats. This protein is thought to function in skeletal muscle development and maintenance. Mutations in this gene have been associated with nemaline myopathy (NM), a rare congenital muscle disorder. [provided by RefSeq, Mar 2015]

Uniprot Description

KBTBD10: Required for pseudopod elongation in transformed cells. Substrate-specific adapter of an E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Contractile; Cell adhesion; Ubiquitin conjugating system; Cytoskeletal

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: ruffle; endoplasmic reticulum membrane; sarcoplasmic reticulum membrane; cytoskeleton; cytoplasm; plasma membrane; M band; pseudopodium; nucleus

Molecular Function: protein binding

Biological Process: myofibril assembly; striated muscle contraction; regulation of myoblast differentiation; protein ubiquitination; regulation of lateral pseudopodium formation

Disease: Nemaline Myopathy 9

Research Articles on KBTBD10

Similar Products

Product Notes

The KBTBD10 klhl41 (Catalog #AAA6147864) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The KBTBD10 (KRP1, Kelch Repeat and BTB Domain-containing Protein 10, Kel-like Protein 23, Kelch-related Protein 1, Sarcosin) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's KBTBD10 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the KBTBD10 klhl41 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "KBTBD10, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.