Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DKKL1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Rabbit DKKL1 Polyclonal Antibody | anti-DKKL1 antibody

DKKL1 antibody - C-terminal region

Gene Names
DKKL1; SGY; CT34; SGY1; SGY-1
Reactivity
Dog, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DKKL1; Polyclonal Antibody; DKKL1 antibody - C-terminal region; anti-DKKL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DALEGGHWLSEKRHRLQAIRDGLRKGTHKDVLEEGTESSSHSRLSPRKTH
Sequence Length
242
Applicable Applications for anti-DKKL1 antibody
Western Blot (WB)
Homology
Dog: 77%; Human: 100%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DKKL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DKKL1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-DKKL1 Antibody Titration: 0.2-1 ug/mlPositive Control: HepG2 cell lysate)
Related Product Information for anti-DKKL1 antibody
This is a rabbit polyclonal antibody against DKKL1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. DKKL1 is a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has high similarity to the N-terminus of the dickkopf-3 protein and moderate similarity to that protein's C-terminus though the C-terminal cysteine residues are not conserved.
Product Categories/Family for anti-DKKL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
dickkopf-like protein 1 isoform 1
NCBI Official Synonym Full Names
dickkopf like acrosomal protein 1
NCBI Official Symbol
DKKL1
NCBI Official Synonym Symbols
SGY; CT34; SGY1; SGY-1
NCBI Protein Information
dickkopf-like protein 1
UniProt Protein Name
Dickkopf-like protein 1
Protein Family
UniProt Gene Name
DKKL1
UniProt Synonym Gene Names
CT34; SGY-1

NCBI Description

The dickkopf protein family interacts with the Wnt signaling pathway and its members are characterized by two conserved cysteine-rich domains. This gene encodes a secreted protein that has low sequence similarity to the dickkopf-3 protein. Multiple alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq, Oct 2010]

Uniprot Description

Involved in fertilization by facilitating sperm penetration of the zona pellucida. May promotes spermatocyte apoptosis, thereby limiting sperm production. In adults, may reduces testosterone synthesis in Leydig cells. Is not essential either for development or fertility.

Research Articles on DKKL1

Similar Products

Product Notes

The DKKL1 dkkl1 (Catalog #AAA3211450) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DKKL1 antibody - C-terminal region reacts with Dog, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DKKL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DKKL1 dkkl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DALEGGHWLS EKRHRLQAIR DGLRKGTHKD VLEEGTESSS HSRLSPRKTH. It is sometimes possible for the material contained within the vial of "DKKL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.