Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-JUN Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293TJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Rabbit JUN Polyclonal Antibody | anti-JUN antibody

JUN antibody - N-terminal region

Gene Names
JUN; AP1; p39; AP-1; c-Jun
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
JUN; Polyclonal Antibody; JUN antibody - N-terminal region; anti-JUN antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP
Sequence Length
331
Applicable Applications for anti-JUN antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 92%; Rat: 92%; Sheep: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human JUN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-JUN Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293TJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)

Western Blot (WB) (WB Suggested Anti-JUN Antibody Titration: 0.2-1 ug/mlPositive Control: Transfected 293TJUN is strongly supported by BioGPS gene expression data to be expressed in Human HEK293T cells)
Related Product Information for anti-JUN antibody
This is a rabbit polyclonal antibody against JUN. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: JUN gene is the putative transforming gene of avian sarcoma virus 17. I JUN is highly similar to the viral protein, and interacts directly with specific target DNA sequences to regulate gene expression. JUN gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies.This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
transcription factor AP-1
NCBI Official Synonym Full Names
Jun proto-oncogene, AP-1 transcription factor subunit
NCBI Official Symbol
JUN
NCBI Official Synonym Symbols
AP1; p39; AP-1; c-Jun
NCBI Protein Information
transcription factor AP-1
UniProt Protein Name
Transcription factor AP-1
Protein Family
UniProt Gene Name
JUN
UniProt Synonym Gene Names
AP1
UniProt Entry Name
JUN_HUMAN

NCBI Description

This gene is the putative transforming gene of avian sarcoma virus 17. It encodes a protein which is highly similar to the viral protein, and which interacts directly with specific target DNA sequences to regulate gene expression. This gene is intronless and is mapped to 1p32-p31, a chromosomal region involved in both translocations and deletions in human malignancies. [provided by RefSeq, Jul 2008]

Uniprot Description

Jun: the protooncogene c-Jun is a component of the transcription factor AP-1, which binds and activates transcription at TRE/AP-1 elements. The Jun Kinases (JNKs) binds to the N-terminal region of c-Jun and phosphorylate it in response to extracellular signals including growth factors, cytokines and stress, regulating its transcriptional activity.

Protein type: Transcription factor; Oncoprotein

Chromosomal Location of Human Ortholog: 1p32-p31

Cellular Component: nucleoplasm; nuclear chromosome; transcription factor complex; transcriptional repressor complex; nucleus; cytosol

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; protein binding; enzyme binding; DNA binding; double-stranded DNA binding; transcription coactivator activity; transcription factor binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; positive regulation of monocyte differentiation; circadian rhythm; response to cAMP; regulation of cell cycle; positive regulation of transcription, DNA-dependent; positive regulation of smooth muscle cell proliferation; stress-activated MAPK cascade; microglial cell activation; response to lipopolysaccharide; SMAD protein nuclear translocation; toll-like receptor 3 signaling pathway; toll-like receptor 10 signaling pathway; toll-like receptor 5 signaling pathway; negative regulation of cell proliferation; positive regulation of fibroblast proliferation; response to radiation; regulation of transcription factor activity; positive regulation of neuron apoptosis; transforming growth factor beta receptor signaling pathway; negative regulation of protein amino acid autophosphorylation; negative regulation of neuron apoptosis; angiogenesis; toll-like receptor 4 signaling pathway; aging; response to drug; release of cytochrome c from mitochondria; monocyte differentiation; leading edge cell differentiation; MyD88-independent toll-like receptor signaling pathway; axon regeneration; learning; liver development; negative regulation of DNA binding; toll-like receptor 2 signaling pathway; MyD88-dependent toll-like receptor signaling pathway; membrane depolarization; cellular response to potassium ion starvation; response to hydrogen peroxide; response to mechanical stimulus; response to cytokine stimulus; toll-like receptor signaling pathway; innate immune response; positive regulation of endothelial cell proliferation; positive regulation of transcription from RNA polymerase II promoter; toll-like receptor 9 signaling pathway; negative regulation of transcription, DNA-dependent; positive regulation of DNA replication

Research Articles on JUN

Similar Products

Product Notes

The JUN jun (Catalog #AAA3224547) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The JUN antibody - N-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's JUN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the JUN jun for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAKMETTFYD DALNASFLPS ESGPYGYSNP KILKQSMTLN LADPVGSLKP. It is sometimes possible for the material contained within the vial of "JUN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.