Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ITSN2 Polyclonal Antibody)

Rabbit anti-Human, Mouse ITSN2 Polyclonal Antibody | anti-ITSN2 antibody

ITSN2 Polyclonal Antibody

Gene Names
ITSN2; SWA; SWAP; SH3D1B; SH3P18; PRO2015
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ITSN2; Polyclonal Antibody; ITSN2 Polyclonal Antibody; PRO2015; SH3D1B; SH3P18; SWA; SWAP; intersectin-2; anti-ITSN2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.27 mg/ml (varies by lot)
Sequence Length
1249
Applicable Applications for anti-ITSN2 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 500-620 of human ITSN2 (NP_006268.2).
Immunogen Sequence
GKHQQISGRLQDVRLKKQTQKTELEVLDKQCDLEIMEIKQLQQELQEYQNKLIYLVPEKQLLNERIKNMQFSNTPDSGVSLLHKKSLEKEELCQRLKEQLDALEKETASKLSEMDSFNNQL
Positive Samples
U-87MG, LO2, Jurkat, HeLa
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ITSN2 Polyclonal Antibody)

Western Blot (WB) (Western blot-ITSN2 Polyclonal Antibody)
Related Product Information for anti-ITSN2 antibody
This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 135kDa; 141kDa; 190kDa; 193kDa
Observed: 180kDa
NCBI Official Full Name
intersectin-2 isoform 2
NCBI Official Synonym Full Names
intersectin 2
NCBI Official Symbol
ITSN2
NCBI Official Synonym Symbols
SWA; SWAP; SH3D1B; SH3P18; PRO2015
NCBI Protein Information
intersectin-2
UniProt Protein Name
Intersectin-2
Protein Family
UniProt Gene Name
ITSN2
UniProt Synonym Gene Names
KIAA1256; SH3D1B; SWAP
UniProt Entry Name
ITSN2_HUMAN

NCBI Description

This gene encodes a cytoplasmic protein which contains SH3 domains. This protein is a member of a family of proteins involved in clathrin-mediated endocytosis. Intersectin 2 is thought to regulate the formation of clathrin-coated vesicles and also may function in the induction of T cell antigen receptor (TCR) endocytosis. [provided by RefSeq, Jan 2017]

Research Articles on ITSN2

Similar Products

Product Notes

The ITSN2 itsn2 (Catalog #AAA9140898) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITSN2 Polyclonal Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ITSN2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ITSN2 itsn2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITSN2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.