Mouse anti-Human HSPE1 Monoclonal Antibody | anti-HSPE1 antibody

HSPE1 (10kD Heat Shock Protein, Mitochondrial, 10kD Chaperonin, Chaperonin 10, CPN10, Early-pregnancy Factor, EPF) (PE)

Cat. Num. AAA6158292

• Gene Names: HSPE1; EPF; CPN10; GROES; HSP10
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HSPE1; Monoclonal Antibody; HSPE1 (10kD Heat Shock Protein; Mitochondrial; 10kD Chaperonin; Chaperonin 10; CPN10; Early-pregnancy Factor; EPF) (PE); anti-HSPE1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 4C11-B11
• Specificity: Recognizes human HSPE1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 556

• Applicable Applications for anti-HSPE1 antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Sandwich ELISA: The detection limit is ~0.1ng/ml as a capture antibody; IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-102 from human HSPE1 (AAH23518) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.96kD).)

Western Blot (WB)

(HSPE1 monoclonal antibody Western Blot analysis of HSPE1 expression in COLO 320 HSR.)

Western Blot (WB)

(Western Blot analysis of HSPE1 expression in transfected 293T cell line by HSPE1 monoclonal antibody. Lane 1: HSPE1 transfected lysate (10.9kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HSPE1 on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HSPE1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-HSPE1 antibody

Antibodies; Heat Shock Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 33871754
• NCBI GeneID: 3336
• NCBI Official Full Name: Homo sapiens heat shock 10kDa protein 1 (chaperonin 10), mRNA
• NCBI Official Synonym Full Names: heat shock protein family E (Hsp10) member 1
• NCBI Official Symbol: HSPE1
• NCBI Official Synonym Symbols: EPF; CPN10; GROES; HSP10
• NCBI Protein Information: 10 kDa heat shock protein, mitochondrial

NCBI Description

This gene encodes a major heat shock protein which functions as a chaperonin. Its structure consists of a heptameric ring which binds to another heat shock protein in order to form a symmetric, functional heterodimer which enhances protein folding in an ATP-dependent manner. This gene and its co-chaperonin, HSPD1, are arranged in a head-to-head orientation on chromosome 2. Naturally occurring read-through transcription occurs between this locus and the neighboring locus MOBKL3.[provided by RefSeq, Feb 2011]