Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ITM2C AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit ITM2C Polyclonal Antibody | anti-ITM2C antibody

ITM2C antibody - middle region

Gene Names
ITM2C; E25; BRI3; E25C; ITM3; BRICD2C
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ITM2C; Polyclonal Antibody; ITM2C antibody - middle region; anti-ITM2C antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDSLSSQVRTQMELEEDVKIYLDENYERINVPVPQFGGGDPADIIHDFQR
Sequence Length
267
Applicable Applications for anti-ITM2C antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%; Sheep: 100%; Zebrafish: 91%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ITM2C AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-ITM2C AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-ITM2C antibody
This is a rabbit polyclonal antibody against ITM2C. It was validated on Western Blot

Target Description: ITM2C is a negative regulator of beta amyloid peptide production. ITM2C may inhibit the processing of APP by blocking its access to alpha- and beta-secretase. Binding to the beta-secretase-cleaved APP C-terminal fragment is negligible, suggesting that ITM2C is a poor gamma-secretase cleavage inhibitor.ITM2C may play a role in TNF-induced cell death and neuronal differentiation.
Product Categories/Family for anti-ITM2C antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
30kDa
NCBI Official Full Name
integral membrane protein 2C isoform 1
NCBI Official Synonym Full Names
integral membrane protein 2C
NCBI Official Symbol
ITM2C
NCBI Official Synonym Symbols
E25; BRI3; E25C; ITM3; BRICD2C
NCBI Protein Information
integral membrane protein 2C
UniProt Protein Name
Integral membrane protein 2C
Protein Family
UniProt Gene Name
ITM2C
UniProt Synonym Gene Names
BRI3
UniProt Entry Name
ITM2C_HUMAN

Uniprot Description

ITM2C: Negative regulator of beta amyloid peptide production. May inhibit the processing of APP by blocking its access to alpha- and beta-secretase. Binding to the beta-secretase-cleaved APP C- terminal fragment is negligible, suggesting that ITM2C is a poor gamma-secretase cleavage inhibitor. May play a role in TNF-induced cell death and neuronal differentiation. Belongs to the ITM2 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 2q37

Cellular Component: Golgi apparatus; lysosomal membrane; perinuclear region of cytoplasm; lysosome; plasma membrane; integral to membrane

Molecular Function: protein binding; beta-amyloid binding; ATP binding

Biological Process: neuron differentiation

Research Articles on ITM2C

Similar Products

Product Notes

The ITM2C itm2c (Catalog #AAA3207462) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITM2C antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's ITM2C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITM2C itm2c for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDSLSSQVRT QMELEEDVKI YLDENYERIN VPVPQFGGGD PADIIHDFQR. It is sometimes possible for the material contained within the vial of "ITM2C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.