Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-TRAF7 Polyclonal Antibody)

Rabbit anti-Rat TRAF7 Polyclonal Antibody | anti-TRAF7 antibody

TRAF7 Polyclonal Antibody

Gene Names
TRAF7; RFWD1; RNF119; CAFDADD
Reactivity
Rat
Applications
Western Blot
Purity
Affinity Purification
Synonyms
TRAF7; Polyclonal Antibody; TRAF7 Polyclonal Antibody; RFWD1; RNF119; TNF receptor associated factor 7; anti-TRAF7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.3 mg/ml (varies by lot)
Sequence Length
670
Applicable Applications for anti-TRAF7 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 260-400 of human TRAF7 (NP_115647.2).
Immunogen Sequence
PHSKYGCTFIGNQDTYETHLETCRFEGLKEFLQQTDDRFHEMHVALAQKDQEIAFLRSMLGKLSEKIDQLEKSLELKFDVLDENQSKLSEDLMEFRRDASMLNDELSHINARLNMGILGSYDPQQIFKCKGTFVGHQGPVW
Positive Samples
Rat Testis, Rat Heart
Cellular Location
Cytoplasmic Vesicle
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-TRAF7 Polyclonal Antibody)

Western Blot (WB) (Western blot-TRAF7 Polyclonal Antibody)
Related Product Information for anti-TRAF7 antibody
Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
Calculated: 66kDa; 74kDa
Observed: 75kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase TRAF7
NCBI Official Synonym Full Names
TNF receptor associated factor 7
NCBI Official Symbol
TRAF7
NCBI Official Synonym Symbols
RFWD1; RNF119; CAFDADD
NCBI Protein Information
E3 ubiquitin-protein ligase TRAF7
UniProt Protein Name
E3 ubiquitin-protein ligase TRAF7
UniProt Gene Name
TRAF7
UniProt Synonym Gene Names
RFWD1; RNF119
UniProt Entry Name
TRAF7_HUMAN

NCBI Description

Tumor necrosis factor (TNF; see MIM 191160) receptor-associated factors, such as TRAF7, are signal transducers for members of the TNF receptor superfamily (see MIM 191190). TRAFs are composed of an N-terminal cysteine/histidine-rich region containing zinc RING and/or zinc finger motifs; a coiled-coil (leucine zipper) motif; and a homologous region that defines the TRAF family, the TRAF domain, which is involved in self-association and receptor binding.[supplied by OMIM, Apr 2004]

Uniprot Description

TRAF7: E3 ubiquitin ligase capable of auto-ubiquitination, following phosphorylation by MAP3K3. Potentiates MEKK3-mediated activation of the NF-kappa-B, JUN/AP1 and DDIT3 transcriptional regulators. Induces apoptosis when overexpressed. Belongs to the WD repeat TRAF7 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; EC 6.3.2.-; Ubiquitin ligase; EC 6.3.2.19; Ligase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: intracellular membrane-bound organelle; perinuclear region of cytoplasm; cytoplasmic membrane-bound vesicle; plasma membrane; nucleus; cytosol; ubiquitin ligase complex

Molecular Function: protein binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: positive regulation of protein sumoylation; regulation of protein localization; positive regulation of MAPKKK cascade; transcription, DNA-dependent; apoptosis; activation of MAPKKK activity; protein ubiquitination; negative regulation of transcription from RNA polymerase II promoter

Research Articles on TRAF7

Similar Products

Product Notes

The TRAF7 traf7 (Catalog #AAA9140607) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TRAF7 Polyclonal Antibody reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TRAF7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the TRAF7 traf7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "TRAF7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.