Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of ITK expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). ITK at 72KD was detected using rabbit anti- ITK Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit anti-Human, Mouse ITK Polyclonal Antibody | anti-ITK antibody

Anti-ITK Antibody

Gene Names
ITK; EMT; LYK; LPFS1; PSCTK2
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
ITK; Polyclonal Antibody; Anti-ITK Antibody; EMT; Itk; LPFS1; LYK; PSCTK 2; PSCTK2; TSK; Q08881; Tyrosine-protein kinase ITK/TSK; IL2 inducible T-cell kinase; anti-ITK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
620
Applicable Applications for anti-ITK antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human ITK (575-617aa FRLYKPRLASTHVYQIMNHCWKERPEDRPAFSRLLRQLAEIAE), different from the related mouse sequence by five amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of ITK expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). ITK at 72KD was detected using rabbit anti- ITK Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of ITK expression in HELA whole cell lysates (lane 1) and NIH3T3 whole cell lysates (lane 2). ITK at 72KD was detected using rabbit anti- ITK Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-ITK antibody
Rabbit IgG polyclonal antibody for Tyrosine-protein kinase ITK/TSK(ITK) detection.
Background: Tyrosine-protein kinase ITK/TSK, also known as interleukin-2-inducible T-cell kinase or simply ITK, is a protein that in humans is encoded by the ITK gene. It is a member of the TEC family of kinases. This gene is mapped to 5q33.3. This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein is thought to play a role in T-cell proliferation and differentiation. Furthermore, ITK is functionally important for the development and effector function of Th2 and Th17 cells.
References
1. "Entrez Gene: ITK IL2-inducible T-cell kinase".
2. Gibson S, Leung B, Squire JA, Hill M, Arima N, Goss P, Hogg D, Mills GB (September 1993)."Identification, cloning, and characterization of a novel human T-cell-specific tyrosine kinase located at the hematopoietin complex on chromosome 5q". Blood. 82 (5): 1561-72.
3. Gomez-Rodriguez J, Kraus ZJ, Schwartzberg PL (March 2011). "Tec family kinases Itk and Rlk/Txk in T lymphocytes: cross-regulation of cytokine production and T-cell fates.". FEBS.278 (12): 1980-1989.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
71,831 Da
NCBI Official Full Name
tyrosine-protein kinase ITK/TSK
NCBI Official Synonym Full Names
IL2 inducible T-cell kinase
NCBI Official Symbol
ITK
NCBI Official Synonym Symbols
EMT; LYK; LPFS1; PSCTK2
NCBI Protein Information
tyrosine-protein kinase ITK/TSK
UniProt Protein Name
Tyrosine-protein kinase ITK/TSK
Protein Family
UniProt Gene Name
ITK
UniProt Synonym Gene Names
EMT; LYK; IL-2-inducible T-cell kinase

NCBI Description

This gene encodes an intracellular tyrosine kinase expressed in T-cells. The protein contains both SH2 and SH3 domains which are often found in intracellular kinases. It is thought to play a role in T-cell proliferation and differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

ITK: an intracellular tyrosine kinase of the Tec family expressed in T-cells. Plays an essential role in regulation of the adaptive immune response. Contains both SH2 and SH3 domains and plays a role in T-cell proliferation and differentiation. Regulates the development, function and differentiation of conventional T-cells and nonconventional NKT-cells. Is recruited to the cell membrane following activation of the T-cell receptor (TCR). It is phosphorylated by LCK, followed by autophosphorylation leading to its full activation. Phosphorylates PLCG1. Itk-deficient murine T cells display defects in TCR/CD3-induced actin polymerization.

Protein type: EC 2.7.10.2; Kinase, protein; Protein kinase, TK; Protein kinase, tyrosine (non-receptor); TK group; Tec family

Chromosomal Location of Human Ortholog: 5q33.3

Cellular Component: cytosol; extrinsic to internal side of plasma membrane

Molecular Function: non-membrane spanning protein tyrosine kinase activity; protein binding; receptor binding

Biological Process: adaptive immune response; cellular defense response; cytokine production; innate immune response; NK T cell differentiation; phospholipase C activation; regulation of cell proliferation; signal transduction; T cell activation; T cell receptor signaling pathway; transmembrane receptor protein tyrosine kinase signaling pathway

Disease: Lymphoproliferative Syndrome 1

Research Articles on ITK

Similar Products

Product Notes

The ITK itk (Catalog #AAA178643) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-ITK Antibody reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ITK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the ITK itk for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ITK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.