Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ITGA6Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human ITGA6 Polyclonal Antibody | anti-ITGA6 antibody

ITGA6 Antibody - N-terminal region

Gene Names
ITGA6; CD49f; VLA-6; ITGA6B
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ITGA6; Polyclonal Antibody; ITGA6 Antibody - N-terminal region; anti-ITGA6 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QGPGGKVVTCAHRYEKRQHVNTKQESRDIFGRCYVLSQNLRIEDDMDGGD
Sequence Length
954
Applicable Applications for anti-ITGA6 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ITGA6
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ITGA6Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ITGA6Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-ITGA6 antibody
The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ITGA6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
104 kDa
NCBI Official Full Name
integrin alpha-6 isoform b preproprotein
NCBI Official Synonym Full Names
integrin subunit alpha 6
NCBI Official Symbol
ITGA6
NCBI Official Synonym Symbols
CD49f; VLA-6; ITGA6B
NCBI Protein Information
integrin alpha-6
UniProt Protein Name
Integrin alpha-6
Protein Family
UniProt Gene Name
ITGA6
UniProt Entry Name
ITA6_HUMAN

NCBI Description

The gene encodes a member of the integrin alpha chain family of proteins. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain that function in cell surface adhesion and signaling. The encoded preproprotein is proteolytically processed to generate light and heavy chains that comprise the alpha 6 subunit. This subunit may associate with a beta 1 or beta 4 subunit to form an integrin that interacts with extracellular matrix proteins including members of the laminin family. The alpha 6 beta 4 integrin may promote tumorigenesis, while the alpha 6 beta 1 integrin may negatively regulate erbB2/HER2 signaling. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2015]

Uniprot Description

ITGA6: Integrin alpha-6/beta-1 is a receptor for laminin on platelets. Integrin alpha-6/beta-4 is a receptor for laminin in epithelial cells and it plays a critical structural role in the hemidesmosome. Heterodimer of an alpha and a beta subunit. The alpha subunit is composed of an heavy and a light chain linked by a disulfide bond. Alpha-6 associates with either beta-1 or beta-4. Interacts with HPS5. Interacts with RAB21. Integrin alpha-6/beta-4 is predominantly expressed by epithelia. Isoforms containing segment X1 are ubiquitously expressed. Isoforms containing segment X1X2 are expressed in heart, kidney, placenta, colon, duodenum, myoblasts and myotubes, and in a limited number of cell lines; they are always coexpressed with the ubiquitous isoform containing segment X1. In some tissues (e.g. Salivary gland), isoforms containing cytoplasmic segment A and isoforms containing segment B are detected while in others, only isoforms containing one cytoplasmic segment are found (segment A in epidermis and segment B in kidney). Belongs to the integrin alpha chain family. 8 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Receptor, misc.; Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 2q31.1

Cellular Component: cell surface; cell-cell adherens junction; focal adhesion; hemidesmosome; plasma membrane; basal plasma membrane; basement membrane; filopodium; external side of plasma membrane

Molecular Function: integrin binding; protein binding; metal ion binding; laminin binding

Biological Process: integrin-mediated signaling pathway; skin development; extracellular matrix organization and biogenesis; filopodium formation; positive regulation of apoptosis; cell-matrix adhesion; cell-substrate adhesion; cell-cell adhesion; hemidesmosome assembly; gut development; cellular response to extracellular stimulus; brown fat cell differentiation; positive regulation of cell-cell adhesion; cell-substrate junction assembly; cell adhesion mediated by integrin; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; leukocyte migration; positive regulation of phosphorylation

Disease: Epidermolysis Bullosa Junctionalis With Pyloric Atresia

Research Articles on ITGA6

Similar Products

Product Notes

The ITGA6 itga6 (Catalog #AAA3222401) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ITGA6 Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ITGA6 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ITGA6 itga6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGPGGKVVTC AHRYEKRQHV NTKQESRDIF GRCYVLSQNL RIEDDMDGGD. It is sometimes possible for the material contained within the vial of "ITGA6, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.