Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IRF2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Rabbit IRF2 Polyclonal Antibody | anti-IRF2 antibody

IRF2 antibody - N-terminal region

Gene Names
IRF2; IRF-2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Protein A purified
Synonyms
IRF2; Polyclonal Antibody; IRF2 antibody - N-terminal region; anti-IRF2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEP
Sequence Length
349
Applicable Applications for anti-IRF2 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human IRF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IRF2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-IRF2 Antibody Titration: 5.0ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-IRF2 antibody
This is a rabbit polyclonal antibody against IRF2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: IRF2 is a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
interferon regulatory factor 2
NCBI Official Synonym Full Names
interferon regulatory factor 2
NCBI Official Symbol
IRF2
NCBI Official Synonym Symbols
IRF-2
NCBI Protein Information
interferon regulatory factor 2
UniProt Protein Name
Interferon regulatory factor 2
UniProt Gene Name
IRF2
UniProt Synonym Gene Names
IRF-2
UniProt Entry Name
IRF2_HUMAN

NCBI Description

IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq, Jul 2008]

Uniprot Description

IRF2: Specifically binds to the upstream regulatory region of type I IFN and IFN-inducible MHC class I genes (the interferon consensus sequence (ICS)) and represses those genes. Also acts as an activator for several genes including H4 and IL7. Constitutively binds to the ISRE promoter to activate IL7. Involved in cell cycle regulation through binding the site II (HiNF-M) promoter region of H4 and activating transcription during cell growth. Antagonizes IRF1 transcriptional activation. Interacts with BRD7, IRF2BP1 and IRF2BP2. Interacts with CREBBP in growing cells; the interaction acetylates IRF2 and regulates IRF2-dependent H4 promoter activity. By viruses and IFN. Expressed throughout the epithelium of the colon. Also expressed in lamina propria. Belongs to the IRF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 4q34.1-q35.1

Cellular Component: nucleoplasm; focal adhesion; cytoplasm; cytosol

Molecular Function: protein binding; DNA binding; transcription factor activity

Biological Process: cell proliferation; regulation of transcription, DNA-dependent; transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription from RNA polymerase II promoter; blood coagulation

Research Articles on IRF2

Similar Products

Product Notes

The IRF2 irf2 (Catalog #AAA3224682) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IRF2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's IRF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IRF2 irf2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IEEVKDKSIK KGNNAFRVYR MLPLSERPSK KGKKPKTEKE DKVKHIKQEP. It is sometimes possible for the material contained within the vial of "IRF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.