Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Acidic mammalian chitinase (CHIA) Recombinant Protein | CHIA recombinant protein

Recombinant Human Acidic mammalian chitinase (CHIA)

Gene Names
CHIA; CHIT2; AMCASE; TSA1902
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Acidic mammalian chitinase (CHIA); Recombinant Human Acidic mammalian chitinase (CHIA); Acidic mammalian chitinase; AMCase; EC=3.2.1.14; Lung-specific protein TSA1902; CHIA recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-368aa; Full Length of Isoform 2
Sequence
MVSTPENRQTFITSVIKFLRQYEFDGLDFDWEYPGSRGSPPQDKHLFTVLVQEMREAFEQEAKQINKPRLMVTAAVAAGISNIQSGYEIPQLSQYLDYIHVMTYDLHGSWEGYTGENSPLYKYPTDTGSNAYLNVDYVMNYWKDNGAPAEKLIVGFPTYGHNFILSNPSNTGIGAPTSGAGPAGPYAKESGIWAYYEICTFLKNGATQGWDAPQEVPYAYQGNVWVGYDNIKSFDIKAQWLKHNKFGGAMVWAIDLDDFTGTFCNQGKFPLISTLKKALGLQSASCTAPAQPIEPITAAPSGSGNGSGSSSSGGSSGGSGFCAVRANGLYPVANNRNAFWHCVNGVTYQQNCQAGLVFDTSCDCCNWA
Sequence Length
455
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for CHIA recombinant protein
Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding.
Product Categories/Family for CHIA recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67.1 kDa
NCBI Official Full Name
acidic mammalian chitinase isoform b
NCBI Official Synonym Full Names
chitinase, acidic
NCBI Official Symbol
CHIA
NCBI Official Synonym Symbols
CHIT2; AMCASE; TSA1902
NCBI Protein Information
acidic mammalian chitinase; lung-specific protein TSA1902
UniProt Protein Name
Acidic mammalian chitinase
UniProt Gene Name
CHIA
UniProt Synonym Gene Names
AMCase
UniProt Entry Name
CHIA_HUMAN

NCBI Description

The protein encoded by this gene degrades chitin, which is found in the cell wall of most fungi as well as in arthropods and some nematodes. The encoded protein can also stimulate interleukin 13 expression, and variations in this gene can lead to asthma susceptibility. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Apr 2012]

Uniprot Description

CHIA: Degrades chitin and chitotriose. May participate in the defense against nematodes, fungi and other pathogens. Plays a role in T-helper cell type 2 (Th2) immune response. Contributes to the response to IL-13 and inflammation in response to IL-13. Stimulates chemokine production by pulmonary epithelial cells. Protects lung epithelial cells against apoptosis and promotes phosphorylation of AKT1. Its function in the inflammatory response and in protecting cells against apoptosis is inhibited by allosamidin, suggesting that the function of this protein depends on carbohydrate binding. Belongs to the glycosyl hydrolase 18 family. Chitinase class II subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Hydrolase; Secreted; Secreted, signal peptide; Carbohydrate Metabolism - amino sugar and nucleotide sugar; EC 3.2.1.14

Chromosomal Location of Human Ortholog: 1p13.2

Cellular Component: extracellular space; cytoplasm

Molecular Function: lysozyme activity; chitin binding; chitinase activity; carbohydrate binding; kinase binding

Biological Process: response to fungus; polysaccharide catabolic process; production of molecular mediator of acute inflammatory response; apoptosis; digestion; cell wall chitin metabolic process; immune response; chitin catabolic process; chitin metabolic process

Research Articles on CHIA

Similar Products

Product Notes

The CHIA chia (Catalog #AAA1376934) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-368aa; Full Length of Isoform 2. The amino acid sequence is listed below: MVSTPENRQT FITSVIKFLR QYEFDGLDFD WEYPGSRGSP PQDKHLFTVL VQEMREAFEQ EAKQINKPRL MVTAAVAAGI SNIQSGYEIP QLSQYLDYIH VMTYDLHGSW EGYTGENSPL YKYPTDTGSN AYLNVDYVMN YWKDNGAPAE KLIVGFPTYG HNFILSNPSN TGIGAPTSGA GPAGPYAKES GIWAYYEICT FLKNGATQGW DAPQEVPYAY QGNVWVGYDN IKSFDIKAQW LKHNKFGGAM VWAIDLDDFT GTFCNQGKFP LISTLKKALG LQSASCTAPA QPIEPITAAP SGSGNGSGSS SSGGSSGGSG FCAVRANGLY PVANNRNAFW HCVNGVTYQQ NCQAGLVFDT SCDCCNWA. It is sometimes possible for the material contained within the vial of "Acidic mammalian chitinase (CHIA), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.