Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IPO8 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Rabbit IPO8 Polyclonal Antibody | anti-IPO8 antibody

IPO8 Antibody - C-terminal region

Gene Names
IPO8; RANBP8
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IPO8; Polyclonal Antibody; IPO8 Antibody - C-terminal region; anti-IPO8 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Horse, Human, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PPAVDAVVGQIVPSILFLFLGLKQVCATRQLVNREDRSKAEKADMEENEE
Sequence Length
832
Applicable Applications for anti-IPO8 antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human IPO8
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IPO8 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)

Western Blot (WB) (WB Suggested Anti-IPO8 AntibodyTitration: 1.0 ug/mlPositive Control: Fetal Kidney)
Related Product Information for anti-IPO8 antibody
This is a rabbit polyclonal antibody against IPO8. It was validated on Western Blot

Target Description: The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-IPO8 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
importin-8 isoform 2
NCBI Official Synonym Full Names
importin 8
NCBI Official Symbol
IPO8
NCBI Official Synonym Symbols
RANBP8
NCBI Protein Information
importin-8
UniProt Protein Name
Importin-8
Protein Family
UniProt Gene Name
IPO8
UniProt Synonym Gene Names
RANBP8; Imp8; RanBP8
UniProt Entry Name
IPO8_HUMAN

NCBI Description

The importin-alpha/beta complex and the GTPase Ran mediate nuclear import of proteins with a classical nuclear localization signal. The protein encoded by this gene is a member of a class of approximately 20 potential Ran targets that share a sequence motif related to the Ran-binding site of importin-beta. This protein binds to the nuclear pore complex and, along with RanGTP and RANBP1, inhibits the GAP stimulation of the Ran GTPase. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2010]

Uniprot Description

IPO8: Seems to function in nuclear protein import, either by acting as autonomous nuclear transport receptor or as an adapter- like protein in association with the importin-beta subunit KPNB1. Acting autonomously, is thought to serve itself as receptor for nuclear localization signals (NLS) and to promote translocation of import substrates through the nuclear pore complex (NPC) by an energy requiring, Ran-dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin, the importin/substrate complex dissociates and importin is re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. In vitro mediates the nuclear import of SRP19. Belongs to the importin beta family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear export; G protein regulator, misc.; Karyopherin; Nuclear import

Chromosomal Location of Human Ortholog: 12p11.21

Cellular Component: nucleoplasm; cytosol

Molecular Function: protein binding; Ran GTPase binding

Biological Process: intracellular protein transport; gene expression; signal transduction

Research Articles on IPO8

Similar Products

Product Notes

The IPO8 ipo8 (Catalog #AAA3216909) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IPO8 Antibody - C-terminal region reacts with Dog, Guinea Pig, Horse, Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's IPO8 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IPO8 ipo8 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PPAVDAVVGQ IVPSILFLFL GLKQVCATRQ LVNREDRSKA EKADMEENEE. It is sometimes possible for the material contained within the vial of "IPO8, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.