Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CAMK2B on HeLa cell. [antibody concentration 25 ug/ml])

Mouse CAMK2B Monoclonal Antibody | anti-CAMK2B antibody

CAMK2B (Calcium/Calmodulin-Dependent Protein Kinase II beta, CAM2, CAMK2, CAMKB, MGC29528) (Biotin)

Gene Names
CAMK2B; CAM2; CAMK2; CAMKB; MRD54; CaMKIIbeta
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
CAMK2B; Monoclonal Antibody; CAMK2B (Calcium/Calmodulin-Dependent Protein Kinase II beta; CAM2; CAMK2; CAMKB; MGC29528) (Biotin); Calcium/Calmodulin-Dependent Protein Kinase II beta; MGC29528; anti-CAMK2B antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
6D6
Specificity
Recognizes CAMK2B.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
503
Applicable Applications for anti-CAMK2B antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CAMK2B (NP_742078, 405aa-502aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FEPEALGNLVEGMDFHRFYFENLLAKNSKPIHTTILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGAPVAPL
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CAMK2B on HeLa cell. [antibody concentration 25 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CAMK2B on HeLa cell. [antibody concentration 25 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to CAMK2B on HeLa cell. [antibody concentration 25 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to CAMK2B on HeLa cell. [antibody concentration 25 ug/ml])

Western Blot (WB)

(CAMK2B monoclonal antibody (M06), clone 6D6. Western Blot analysis of CAMK2B expression in HeLa.)

Western Blot (WB) (CAMK2B monoclonal antibody (M06), clone 6D6. Western Blot analysis of CAMK2B expression in HeLa.)
Product Categories/Family for anti-CAMK2B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
816
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
calcium/calmodulin-dependent protein kinase type II subunit beta isoform 5
NCBI Official Synonym Full Names
calcium/calmodulin dependent protein kinase II beta
NCBI Official Symbol
CAMK2B
NCBI Official Synonym Symbols
CAM2; CAMK2; CAMKB; MRD54; CaMKIIbeta
NCBI Protein Information
calcium/calmodulin-dependent protein kinase type II subunit beta
UniProt Protein Name
Calcium/calmodulin-dependent protein kinase type II subunit beta
UniProt Gene Name
CAMK2B
UniProt Synonym Gene Names
CAM2; CAMK2; CAMKB; CaM kinase II subunit beta; CaMK-II subunit beta
UniProt Entry Name
KCC2B_HUMAN

NCBI Description

The product of this gene belongs to the serine/threonine protein kinase family and to the Ca(2+)/calmodulin-dependent protein kinase subfamily. Calcium signaling is crucial for several aspects of plasticity at glutamatergic synapses. In mammalian cells, the enzyme is composed of four different chains: alpha, beta, gamma, and delta. The product of this gene is a beta chain. It is possible that distinct isoforms of this chain have different cellular localizations and interact differently with calmodulin. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]

Uniprot Description

CAMK2B: a widely expressed protein kinase of the calcium/calmodulin-dependent protein kinase (CAMK) group. Functions autonomously after Ca2+/calmodulin-binding and autophosphorylation. Involved in dendritic spine and synapse formation, neuronal plasticity and regulation of sarcoplasmic reticulum Ca2+ transport in skeletal muscle. In neurons, plays an essential structural role in the reorganization of the actin cytoskeleton during plasticity by binding and bundling actin filaments in a kinase-independent manner. This structural function is required for correct targeting of CaMK2A, which acts downstream of NMDAR to promote dendritic spine and synapse formation and maintain synaptic plasticity which enables long-term potentiation (LTP) and hippocampus-dependent learning. In developing hippocampal neurons, promotes arborization of the dendritic tree and in mature neurons, promotes dendritic remodeling. Participates in the modulation of skeletal muscle function in response to exercise. In slow-twitch muscles, is involved in regulation of sarcoplasmic reticulum (SR) Ca2+ transport and in fast-twitch muscle participates in the control of Ca2+ release from the SR through phosphorylation of triadin, a ryanodine receptor-coupling factor, and phospholamban, an endogenous inhibitor of SERCA2. The holoenzyme is composed of 4 different chains: alpha (CAMK2A), beta (CAMK2B), gamma (CAMK2G), and delta (CAMK2D). The different isoforms assemble into homo- or heteromultimeric holoenzymes composed of 12 subunits with two hexameric rings stacked one on top of the other. Interacts with SYNGAP1 and CAMK2N2. Interacts with MPDZ. Expressed in adult and fetal brain. Expression is slightly lower in fetal brain. Expressed in skeletal muscle and induced during exercise. Eight isoforms of the human protein are produced by alternative splicing

Protein type: EC 2.7.11.17; Kinase, protein; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); CAMK group; CAMK2 family

Chromosomal Location of Human Ortholog: 7p14.3-p14.1

Cellular Component: nucleoplasm; sarcoplasmic reticulum membrane; plasma membrane; microtubule organizing center; spindle midzone; cytosol

Molecular Function: calmodulin binding; protein homodimerization activity; calmodulin-dependent protein kinase activity; actin binding; ATP binding

Biological Process: regulation of long-term neuronal synaptic plasticity; regulation of skeletal muscle adaptation; protein amino acid autophosphorylation; cytokine and chemokine mediated signaling pathway; regulation of calcium ion transport; signal transduction; protein amino acid phosphorylation; regulation of synaptic transmission, cholinergic; inhibitory G-protein coupled receptor phosphorylation; synaptic transmission; peptidyl-serine phosphorylation; response to cadmium ion; calcium ion transport; regulation of synapse structural plasticity; neuromuscular process controlling balance; G1/S transition of mitotic cell cycle

Research Articles on CAMK2B

Similar Products

Product Notes

The CAMK2B camk2b (Catalog #AAA6170357) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CAMK2B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CAMK2B camk2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CAMK2B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.