Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (IRF9 rabbit polyclonal antibody. Western Blot analysis of IRF9 expression in human pancreas.)

Rabbit anti-Human Interferon Regulatory Factor 9 Polyclonal Antibody | anti-IRF9 antibody

Interferon Regulatory Factor 9 (IRF9, IRF-9, IFN-alpha-responsive Transcription Factor Subunit, Interferon-stimulated Gene Factor 3 gamma, ISGF3, ISGF3G, ISGF-3 gamma, ISGF3 p48 subunit, p48, Transcriptional Regulator ISGF3 Subunit gamma) APC

Gene Names
IRF9; p48; IRF-9; ISGF3; ISGF3G
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Interferon Regulatory Factor 9; Polyclonal Antibody; Interferon Regulatory Factor 9 (IRF9; IRF-9; IFN-alpha-responsive Transcription Factor Subunit; Interferon-stimulated Gene Factor 3 gamma; ISGF3; ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; p48; Transcriptional Regulator ISGF3 Subunit gamma) APC; anti-IRF9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human IRF9.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-IRF9 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full-length human IRF9, aa1-393 (NP_006075.3).
Immunogen Sequence
MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(IRF9 rabbit polyclonal antibody. Western Blot analysis of IRF9 expression in human pancreas.)

Western Blot (WB) (IRF9 rabbit polyclonal antibody. Western Blot analysis of IRF9 expression in human pancreas.)

Western Blot (WB)

(Western Blot analysis of IRF9 expression in transfected 293T cell line by IRF9 polyclonal antibody. Lane 1: IRF9 transfected lysate (43.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of IRF9 expression in transfected 293T cell line by IRF9 polyclonal antibody. Lane 1: IRF9 transfected lysate (43.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-IRF9 antibody
IRF9 is a transcription regulatory factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state.
Product Categories/Family for anti-IRF9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,696 Da
NCBI Official Full Name
interferon regulatory factor 9
NCBI Official Synonym Full Names
interferon regulatory factor 9
NCBI Official Symbol
IRF9
NCBI Official Synonym Symbols
p48; IRF-9; ISGF3; ISGF3G
NCBI Protein Information
interferon regulatory factor 9
UniProt Protein Name
Interferon regulatory factor 9
UniProt Gene Name
IRF9
UniProt Synonym Gene Names
ISGF3G; IRF-9; ISGF-3 gamma
UniProt Entry Name
IRF9_HUMAN

Uniprot Description

IRF9: Transcription regulatory factor that mediates signaling by type I IFNs (IFN-alpha and IFN-beta). Following type I IFN binding to cell surface receptors, Jak kinases (TYK2 and JAK1) are activated, leading to tyrosine phosphorylation of STAT1 and STAT2. The phosphorylated STATs dimerize, associate with IRF9/ISGF3G to form a complex termed ISGF3 transcription factor, that enters the nucleus. ISGF3 binds to the IFN stimulated response element (ISRE) to activate the transcription of interferon stimulated genes, which drive the cell in an antiviral state. Belongs to the IRF family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: protein binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; cell surface receptor linked signal transduction; regulation of transcription, DNA-dependent; cytokine and chemokine mediated signaling pathway; interferon type I biosynthetic process; defense response to virus

Research Articles on IRF9

Similar Products

Product Notes

The IRF9 irf9 (Catalog #AAA6382971) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Interferon Regulatory Factor 9 (IRF9, IRF-9, IFN-alpha-responsive Transcription Factor Subunit, Interferon-stimulated Gene Factor 3 gamma, ISGF3, ISGF3G, ISGF-3 gamma, ISGF3 p48 subunit, p48, Transcriptional Regulator ISGF3 Subunit gamma) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Interferon Regulatory Factor 9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the IRF9 irf9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Interferon Regulatory Factor 9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.