Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Reactivity Data

Goat Insulin Polyclonal Antibody | anti-INS antibody

Insulin Polyclonal Antibody

Gene Names
INS; IDDM; ILPR; IRDN; IDDM1; IDDM2; MODY10
Reactivity
Human, Rat, Mouse, Canine, and Monkey proteins.
Applications
Western Blot
Purity
Epitope Affinity Purified
Synonyms
Insulin; Polyclonal Antibody; Insulin Polyclonal Antibody; Anti-INS; IDDM; IDDM1; IDDM2; ILPR; IRDN; MODY10 antibody; anti-INS antibody
Ordering
For Research Use Only!
Host
Goat
Reactivity
Human, Rat, Mouse, Canine, and Monkey proteins.
Clonality
Polyclonal
Isotype
IgG
Specificity
Gives a positive signal using MBP-Insulin recombinant fusion protein by WB.
Purity/Purification
Epitope Affinity Purified
Form/Format
Polyclonal antibody supplied as a 200 ul (3 mg/ml) aliquot in PBS, 20% glycerol and 0.05% sodium azide. This antibody is epitope-affinity purified from goat antiserum.
Concentration
3 mg/ml (varies by lot)
Sequence Positions
MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN
Sequence Length
110
Applicable Applications for anti-INS antibody
Western Blot (WB)
Application Notes
Western blot: 1:250-1:2,000
Immunogen
Recombinant human Insulin produced in E Coli as a fusion protein.
Preparation and Storage
Long-term storage: Store at -20 degree C.
Short term storage: Store at 2-8 degree C for up to one month.
Avoid freeze/thaw cycles.

Reactivity Data

Reactivity Data

Testing Data

Testing Data
Related Product Information for anti-INS antibody
Goat polyclonal to Insulin. Insulin is a 6 kDa peptide, first synthesized as a precursor molecule, preproinsulin which is then processed into proinsulin and finally to the mature insulin.  An increase in blood glucose levels during stimulates insulin release from pancreatic ? cells. Binding of insulin to the insulin receptor (INSR) stimulates glucose uptake.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
insulin
NCBI Official Synonym Full Names
insulin
NCBI Official Symbol
INS
NCBI Official Synonym Symbols
IDDM; ILPR; IRDN; IDDM1; IDDM2; MODY10
NCBI Protein Information
insulin
UniProt Protein Name
Insulin
Protein Family
UniProt Gene Name
INS
UniProt Entry Name
INS_HUMAN

Uniprot Description

Insulin: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Heterodimer of a B chain and an A chain linked by two disulfide bonds. Belongs to the insulin family.

Protein type: Hormone; Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 11p15.5

Cellular Component: endoplasmic reticulum lumen; ER-Golgi intermediate compartment membrane; extracellular region; extracellular space; Golgi lumen; Golgi membrane; transport vesicle

Molecular Function: hormone activity; identical protein binding; insulin receptor binding; insulin-like growth factor receptor binding; protease binding; protein binding

Biological Process: activation of NF-kappaB transcription factor; activation of protein kinase B; acute-phase response; alpha-beta T cell activation; cell-cell signaling; cellular protein metabolic process; ER to Golgi vesicle-mediated transport; fatty acid homeostasis; G-protein coupled receptor protein signaling pathway; glucose homeostasis; glucose transport; insulin receptor signaling pathway; MAPKKK cascade; negative regulation of acute inflammatory response; negative regulation of fatty acid metabolic process; negative regulation of glycogen catabolic process; negative regulation of lipid catabolic process; negative regulation of NAD(P)H oxidase activity; negative regulation of protein catabolic process; negative regulation of protein oligomerization; negative regulation of protein secretion; negative regulation of proteolysis; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of cellular protein metabolic process; positive regulation of cytokine secretion; positive regulation of DNA replication; positive regulation of glucose import; positive regulation of glycogen biosynthetic process; positive regulation of glycolysis; positive regulation of insulin receptor signaling pathway; positive regulation of MAPKKK cascade; positive regulation of mitosis; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein amino acid autophosphorylation; positive regulation of protein kinase B signaling cascade; regulation of amino acid metabolic process; regulation of protein localization; regulation of protein secretion; regulation of transmembrane transporter activity; wound healing

Disease: Diabetes Mellitus, Insulin-dependent, 2; Diabetes Mellitus, Permanent Neonatal; Hyperproinsulinemia; Maturity-onset Diabetes Of The Young, Type 10

Similar Products

Product Notes

The INS ins (Catalog #AAA448113) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN. The Insulin Polyclonal Antibody reacts with Human, Rat, Mouse, Canine, and Monkey proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Insulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western blot: 1:250-1:2,000. Researchers should empirically determine the suitability of the INS ins for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Insulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.