Reactivity Data
Goat Insulin Polyclonal Antibody | anti-INS antibody
Insulin Polyclonal Antibody
Short term storage: Store at 2-8 degree C for up to one month.
Avoid freeze/thaw cycles.
Reactivity Data
Reactivity Data
Testing Data
Testing Data
NCBI and Uniprot Product Information
Uniprot Description
Insulin: Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Heterodimer of a B chain and an A chain linked by two disulfide bonds. Belongs to the insulin family.
Protein type: Hormone; Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 11p15.5
Cellular Component: endoplasmic reticulum lumen; ER-Golgi intermediate compartment membrane; extracellular region; extracellular space; Golgi lumen; Golgi membrane; transport vesicle
Molecular Function: hormone activity; identical protein binding; insulin receptor binding; insulin-like growth factor receptor binding; protease binding; protein binding
Biological Process: activation of NF-kappaB transcription factor; activation of protein kinase B; acute-phase response; alpha-beta T cell activation; cell-cell signaling; cellular protein metabolic process; ER to Golgi vesicle-mediated transport; fatty acid homeostasis; G-protein coupled receptor protein signaling pathway; glucose homeostasis; glucose transport; insulin receptor signaling pathway; MAPKKK cascade; negative regulation of acute inflammatory response; negative regulation of fatty acid metabolic process; negative regulation of glycogen catabolic process; negative regulation of lipid catabolic process; negative regulation of NAD(P)H oxidase activity; negative regulation of protein catabolic process; negative regulation of protein oligomerization; negative regulation of protein secretion; negative regulation of proteolysis; positive regulation of cell migration; positive regulation of cell proliferation; positive regulation of cellular protein metabolic process; positive regulation of cytokine secretion; positive regulation of DNA replication; positive regulation of glucose import; positive regulation of glycogen biosynthetic process; positive regulation of glycolysis; positive regulation of insulin receptor signaling pathway; positive regulation of MAPKKK cascade; positive regulation of mitosis; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of protein amino acid autophosphorylation; positive regulation of protein kinase B signaling cascade; regulation of amino acid metabolic process; regulation of protein localization; regulation of protein secretion; regulation of transmembrane transporter activity; wound healing
Disease: Diabetes Mellitus, Insulin-dependent, 2; Diabetes Mellitus, Permanent Neonatal; Hyperproinsulinemia; Maturity-onset Diabetes Of The Young, Type 10
Similar Products
Product Notes
The INS ins (Catalog #AAA448113) is an Antibody produced from Goat and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is MFVNQHLCGSHLVEALYLVCGERGFFYTPKTGIVEQCCTSICSLYQLENYCN. The Insulin Polyclonal Antibody reacts with Human, Rat, Mouse, Canine, and Monkey proteins. and may cross-react with other species as described in the data sheet. AAA Biotech's Insulin can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western blot: 1:250-1:2,000. Researchers should empirically determine the suitability of the INS ins for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Insulin, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
