Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL5RA AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit IL5RA Polyclonal Antibody | anti-IL5RA antibody

IL5RA antibody - N-terminal region

Gene Names
IL5RA; IL5R; CD125; CDw125; HSIL5R3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL5RA; Polyclonal Antibody; IL5RA antibody - N-terminal region; anti-IL5RA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GLAQVLLQWKPNPDQEQRNVNLEYQVKINAPKEDDYETRITESKCVTILH
Sequence Length
420
Applicable Applications for anti-IL5RA antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 79%; Guinea Pig: 79%; Horse: 79%; Human: 100%; Mouse: 79%; Pig: 86%; Rat: 79%; Yeast: 91%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL5RA AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-IL5RA AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-IL5RA antibody
This is a rabbit polyclonal antibody against IL5RA. It was validated on Western Blot

Target Description: The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported.
Product Categories/Family for anti-IL5RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46kDa
NCBI Official Full Name
interleukin-5 receptor subunit alpha isoform 1
NCBI Official Synonym Full Names
interleukin 5 receptor subunit alpha
NCBI Official Symbol
IL5RA
NCBI Official Synonym Symbols
IL5R; CD125; CDw125; HSIL5R3
NCBI Protein Information
interleukin-5 receptor subunit alpha
UniProt Protein Name
Interleukin-5 receptor subunit alpha
Protein Family
UniProt Gene Name
IL5RA
UniProt Synonym Gene Names
IL5R; IL-5 receptor subunit alpha; IL-5R subunit alpha; IL-5R-alpha; IL-5RA
UniProt Entry Name
IL5RA_HUMAN

NCBI Description

The protein encoded by this gene is an interleukin 5 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL5 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL5. This protein has been found to interact with syndecan binding protein (syntenin), which is required for IL5 mediated activation of the transcription factor SOX4. Several alternatively spliced transcript variants encoding four distinct isoforms have been reported. [provided by RefSeq, Jul 2011]

Uniprot Description

IL5RA: This is the receptor for interleukin-5. The alpha chain binds to IL5. Belongs to the type I cytokine receptor family. Type 5 subfamily. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 3p26-p24

Cellular Component: extracellular space; plasma membrane; integral to membrane

Molecular Function: protein binding; interleukin-5 receptor activity

Biological Process: cell proliferation; regulation of interleukin-5 production; inflammatory response to antigenic stimulus; signal transduction

Research Articles on IL5RA

Similar Products

Product Notes

The IL5RA il5ra (Catalog #AAA3216089) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL5RA antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's IL5RA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL5RA il5ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GLAQVLLQWK PNPDQEQRNV NLEYQVKINA PKEDDYETRI TESKCVTILH. It is sometimes possible for the material contained within the vial of "IL5RA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.