Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL3RA AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Rabbit anti-Human IL3RA Polyclonal Antibody | anti-IL3RA antibody

IL3RA antibody - C-terminal region

Gene Names
IL3RA; IL3R; CD123; IL3RX; IL3RY; IL3RAY; hIL-3Ra
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL3RA; Polyclonal Antibody; IL3RA antibody - C-terminal region; anti-IL3RA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRF
Sequence Length
378
Applicable Applications for anti-IL3RA antibody
Western Blot (WB)
Homology
Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL3RA AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)

Western Blot (WB) (WB Suggested Anti-IL3RA AntibodyTitration: 1.0 ug/mlPositive Control: MCF7 Whole Cell)
Related Product Information for anti-IL3RA antibody
This is a rabbit polyclonal antibody against IL3RA. It was validated on Western Blot

Target Description: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y.
Product Categories/Family for anti-IL3RA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
Interleukin-3 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 3 receptor subunit alpha
NCBI Official Symbol
IL3RA
NCBI Official Synonym Symbols
IL3R; CD123; IL3RX; IL3RY; IL3RAY; hIL-3Ra
NCBI Protein Information
interleukin-3 receptor subunit alpha
UniProt Protein Name
Interleukin-3 receptor subunit alpha
Protein Family
UniProt Gene Name
IL3RA
UniProt Synonym Gene Names
IL3R; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA
UniProt Entry Name
IL3RA_HUMAN

NCBI Description

The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jun 2012]

Uniprot Description

IL3RA: This is a receptor for interleukin-3. Belongs to the type I cytokine receptor family. Type 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.3 or Yp11.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: interleukin-3 receptor activity

Research Articles on IL3RA

Similar Products

Product Notes

The IL3RA il3ra (Catalog #AAA3216158) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL3RA antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL3RA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL3RA il3ra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IQKRMQPVIT EQVRDRTSFQ LLNPGTYTVQ IRARERVYEF LSAWSTPQRF. It is sometimes possible for the material contained within the vial of "IL3RA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.