Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IL3RA/CD123 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 52-60 kDa.)

IL3RA/CD123 active protein

Recombinant Human IL3RA/CD123 Protein

Gene Names
IL3RA; IL3R; CD123; IL3RX; IL3RY; IL3RAY; hIL-3Ra
Purity
>82% by SDS-PAGE.
Synonyms
IL3RA/CD123; Recombinant Human IL3RA/CD123 Protein; CD123; hIL-3Ra; IL3R; IL3RAY; IL3RX; IL3RY; IL3RA/CD123 active protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>82% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
Sequence
KEDPNPPITNLRMKAKAQQLTWDLNRNVTDIECVKDADYSMPAVNNSYCQFGAISLCEVTNYTVRVANPPFSTWILFPENSGKPWAGAENLTCWIHDVDFLSCSWAVGPGAPADVQYDLYLNVANRRQQYECLHYKTDAQGTRIGCRFDDISRLSSGSQSSHILVRGRSAAFGIPCTDKFVVFSQIEILTPPNMTAKCNKTHSFMHWKMRSHFNRKFRYELQIQKRMQPVITEQVRDRTSFQLLNPGTYTVQIRARERVYEFLSAWSTPQRFECDQEEGANTRAWR
Sequence Length
378
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its binding ability in a functional ELISA. When Recombinant Human IL3RA/CD123 is present at 1 ug/mL, the concentration of Recominant Human IL-3 that produces 50% of the optimal binding response is found to be approximately 8-40 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IL3RA/CD123 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 52-60 kDa.)

SDS-Page (Recombinant Human IL3RA/CD123 Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 52-60 kDa.)
Related Product Information for IL3RA/CD123 active protein
Description: Recombinant Human IL3RA/CD123 Protein is produced by HEK293 expression system. The target protein is expressed with sequence (Lys20-Arg305) of human IL3RA/CD123 (Accession #NP_002174.1) fused with a 6xHis tag at the C-terminus.

Background: The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found.
Product Categories/Family for IL3RA/CD123 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
NCBI Official Full Name
Interleukin-3 receptor subunit alpha
NCBI Official Synonym Full Names
interleukin 3 receptor subunit alpha
NCBI Official Symbol
IL3RA
NCBI Official Synonym Symbols
IL3R; CD123; IL3RX; IL3RY; IL3RAY; hIL-3Ra
NCBI Protein Information
interleukin-3 receptor subunit alpha
UniProt Protein Name
Interleukin-3 receptor subunit alpha
UniProt Gene Name
IL3RA
UniProt Synonym Gene Names
IL3R; IL-3 receptor subunit alpha; IL-3R subunit alpha; IL-3R-alpha; IL-3RA
UniProt Entry Name
IL3RA_HUMAN

NCBI Description

The protein encoded by this gene is an interleukin 3 specific subunit of a heterodimeric cytokine receptor. The receptor is comprised of a ligand specific alpha subunit and a signal transducing beta subunit shared by the receptors for interleukin 3 (IL3), colony stimulating factor 2 (CSF2/GM-CSF), and interleukin 5 (IL5). The binding of this protein to IL3 depends on the beta subunit. The beta subunit is activated by the ligand binding, and is required for the biological activities of IL3. This gene and the gene encoding the colony stimulating factor 2 receptor alpha chain (CSF2RA) form a cytokine receptor gene cluster in a X-Y pseudoautosomal region on chromosomes X or Y. Alternatively spliced transcript variants encoding distinct isoforms have been found. [provided by RefSeq, Jun 2012]

Uniprot Description

IL3RA: This is a receptor for interleukin-3. Belongs to the type I cytokine receptor family. Type 5 subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: Xp22.3 or Yp11.3

Cellular Component: plasma membrane; integral to membrane

Molecular Function: interleukin-3 receptor activity

Research Articles on IL3RA/CD123

Similar Products

Product Notes

The IL3RA/CD123 il3ra (Catalog #AAA9139718) is an Active Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: KEDPNPPITN LRMKAKAQQL TWDLNRNVTD IECVKDADYS MPAVNNSYCQ FGAISLCEVT NYTVRVANPP FSTWILFPEN SGKPWAGAEN LTCWIHDVDF LSCSWAVGPG APADVQYDLY LNVANRRQQY ECLHYKTDAQ GTRIGCRFDD ISRLSSGSQS SHILVRGRSA AFGIPCTDKF VVFSQIEILT PPNMTAKCNK THSFMHWKMR SHFNRKFRYE LQIQKRMQPV ITEQVRDRTS FQLLNPGTYT VQIRARERVY EFLSAWSTPQ RFECDQEEGA NTRAWR. It is sometimes possible for the material contained within the vial of "IL3RA/CD123, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.