Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL34Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit IL34 Polyclonal Antibody | anti-IL34 antibody

IL34 Antibody - N-terminal region

Gene Names
IL34; IL-34; C16orf77
Reactivity
Dog, Horse, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL34; Polyclonal Antibody; IL34 Antibody - N-terminal region; anti-IL34 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Horse, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ALGNEPLEMWPLTQNEECTVTGFLRDKLQYRSRLQYMKHYFPINYKISVP
Sequence Length
241
Applicable Applications for anti-IL34 antibody
Western Blot (WB)
Homology
Dog: 93%; Horse: 86%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human IL34
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL34Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL34Sample Type: U937 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IL34 antibody
This is a rabbit polyclonal antibody against IL34. It was validated on Western Blot

Target Description: Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor.
Product Categories/Family for anti-IL34 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
26kDa
NCBI Official Full Name
interleukin-34 isoform 2
NCBI Official Synonym Full Names
interleukin 34
NCBI Official Symbol
IL34
NCBI Official Synonym Symbols
IL-34; C16orf77
NCBI Protein Information
interleukin-34
UniProt Protein Name
Interleukin-34
Protein Family
UniProt Gene Name
IL34
UniProt Synonym Gene Names
C16orf77; IL-34
UniProt Entry Name
IL34_HUMAN

NCBI Description

Interleukin-34 is a cytokine that promotes the differentiation and viability of monocytes and macrophages through the colony-stimulating factor-1 receptor (CSF1R; MIM 164770) (Lin et al., 2008 [PubMed 18467591]).[supplied by OMIM, May 2008]

Uniprot Description

IL34: Cytokine that promotes the proliferation, survival and differentiation of monocytes and macrophages. Promotes the release of proinflammatory chemokines, and thereby plays an important role in innate immunity and in inflammatory processes. Plays an important role in the regulation of osteoclast proliferation and differentiation, and in the regulation of bone resorption. Signaling via CSF1R and its downstream effectors stimulates phosphorylation of MAPK1/ERK2 AND MAPK3/ERK1. Belongs to the IL-34 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted, signal peptide; Secreted; Cell cycle regulation; Cytokine

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: extracellular space

Molecular Function: growth factor activity; cytokine activity; macrophage colony stimulating factor receptor binding

Biological Process: positive regulation of cell proliferation; innate immune response; positive regulation of protein amino acid phosphorylation; inflammatory response

Research Articles on IL34

Similar Products

Product Notes

The IL34 il34 (Catalog #AAA3217835) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL34 Antibody - N-terminal region reacts with Dog, Horse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL34 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL34 il34 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ALGNEPLEMW PLTQNEECTV TGFLRDKLQY RSRLQYMKHY FPINYKISVP. It is sometimes possible for the material contained within the vial of "IL34, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.