Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: IL32Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human IL32 Polyclonal Antibody | anti-IL32 antibody

IL32 Antibody - middle region

Gene Names
IL32; NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL32; Polyclonal Antibody; IL32 Antibody - middle region; anti-IL32 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRL
Sequence Length
234
Applicable Applications for anti-IL32 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human IL32
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: IL32Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: IL32Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-IL32 antibody
This is a rabbit polyclonal antibody against IL32. It was validated on Western Blot

Target Description: This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.
Product Categories/Family for anti-IL32 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25kDa
NCBI Official Full Name
interleukin-32 isoform B
NCBI Official Synonym Full Names
interleukin 32
NCBI Official Symbol
IL32
NCBI Official Synonym Symbols
NK4; TAIF; TAIFa; TAIFb; TAIFc; TAIFd; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma
NCBI Protein Information
interleukin-32
UniProt Protein Name
Interleukin-32
Protein Family
UniProt Gene Name
IL32
UniProt Synonym Gene Names
NK4; TAIF; IL-32
UniProt Entry Name
IL32_HUMAN

NCBI Description

This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

IL32: Cytokine that may play a role in innate and adaptive immune responses. It induces various cytokines such as TNFA/TNF- alpha and IL8. It activates typical cytokine signal pathways of NF-kappa-B and p38 MAPK. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell adhesion; Secreted, signal peptide; Secreted

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: extracellular space; membrane

Molecular Function: protein binding; cytokine activity

Biological Process: defense response; immune response; cell adhesion

Research Articles on IL32

Similar Products

Product Notes

The IL32 il32 (Catalog #AAA3214932) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL32 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's IL32 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL32 il32 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPLLEKERDG LRCRGNRSPV PDVEDPATEE PGESFCDKVM RWFQAMLQRL. It is sometimes possible for the material contained within the vial of "IL32, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.