Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-IL2RB AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit IL2RB Polyclonal Antibody | anti-IL2RB antibody

IL2RB antibody - C-terminal region

Gene Names
IL2RB; CD122; IL15RB; P70-75
Reactivity
Human, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL2RB; Polyclonal Antibody; IL2RB antibody - C-terminal region; anti-IL2RB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: QGYFFFHLPDALEIEACQVYFTYDPYSEEDPDEGVAGAPTGSSPQPLQPL
Sequence Length
551
Applicable Applications for anti-IL2RB antibody
Western Blot (WB)
Homology
Human: 100%; Rat: 77%; Yeast: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-IL2RB AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-IL2RB AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-IL2RB antibody
This is a rabbit polyclonal antibody against IL2RB. It was validated on Western Blot

Target Description: The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein.
Product Categories/Family for anti-IL2RB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
58kDa
NCBI Official Full Name
interleukin-2 receptor subunit beta
NCBI Official Synonym Full Names
interleukin 2 receptor subunit beta
NCBI Official Symbol
IL2RB
NCBI Official Synonym Symbols
CD122; IL15RB; P70-75
NCBI Protein Information
interleukin-2 receptor subunit beta
UniProt Protein Name
Interleukin-2 receptor subunit beta
Protein Family
UniProt Gene Name
IL2RB
UniProt Synonym Gene Names
IL-2 receptor subunit beta; IL-2R subunit beta; IL-2RB; p75
UniProt Entry Name
IL2RB_HUMAN

NCBI Description

The interleukin 2 receptor, which is involved in T cell-mediated immune responses, is present in 3 forms with respect to ability to bind interleukin 2. The low affinity form is a monomer of the alpha subunit and is not involved in signal transduction. The intermediate affinity form consists of an alpha/beta subunit heterodimer, while the high affinity form consists of an alpha/beta/gamma subunit heterotrimer. Both the intermediate and high affinity forms of the receptor are involved in receptor-mediated endocytosis and transduction of mitogenic signals from interleukin 2. The protein encoded by this gene represents the beta subunit and is a type I membrane protein. The use of alternative promoters results in multiple transcript variants encoding the same protein. The protein is primarily expressed in the hematopoietic system. The use by some variants of an alternate promoter in an upstream long terminal repeat (LTR) results in placenta-specific expression. [provided by RefSeq, Sep 2016]

Uniprot Description

IL2RB: Receptor for interleukin-2. This beta subunit is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. Non-covalent dimer of an alpha and a beta subunit. IL2R exists in 3 different forms: a high affinity dimer, an intermediate affinity monomer (beta subunit), and a low affinity monomer (alpha subunit). The high and intermediate affinity forms also associate with a gamma subunit. Interacts with SHB upon interleukin stimulation. Interacts with HTLV-1 accessory protein p12I. Belongs to the type I cytokine receptor family. Type 4 subfamily.

Protein type: Membrane protein, integral; Receptor, cytokine

Chromosomal Location of Human Ortholog: 22q13.1

Cellular Component: membrane; integral to plasma membrane; plasma membrane; external side of plasma membrane

Molecular Function: interleukin-2 receptor activity; interleukin-2 binding

Biological Process: viral reproduction; cytokine and chemokine mediated signaling pathway; protein complex assembly; signal transduction; negative regulation of apoptosis

Research Articles on IL2RB

Similar Products

Product Notes

The IL2RB il2rb (Catalog #AAA3215120) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL2RB antibody - C-terminal region reacts with Human, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's IL2RB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL2RB il2rb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: QGYFFFHLPD ALEIEACQVY FTYDPYSEED PDEGVAGAPT GSSPQPLQPL. It is sometimes possible for the material contained within the vial of "IL2RB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.