Western Blot (WB)
(WB Suggested Anti-IL26 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Rabbit IL26 Polyclonal Antibody | anti-IL26 antibody
IL26 antibody - N-terminal region
Gene Names
IL26; AK155; IL-26
Reactivity
Dog, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
IL26; Polyclonal Antibody; IL26 antibody - N-terminal region; anti-IL26 antibody
Host
Rabbit
Reactivity
Dog, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IKAAWLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQ
Sequence Length
171
Applicable Applications for anti-IL26 antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Pig: 86%; Rabbit: 82%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-IL26 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Western Blot (WB)
(WB Suggested Anti-IL26 AntibodyTitration: 1.0 ug/mlPositive Control: ACHN Whole Cell)
Related Product Information for anti-IL26 antibody
This is a rabbit polyclonal antibody against IL26. It was validated on Western Blot
Target Description: This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri.
Target Description: This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri.
Product Categories/Family for anti-IL26 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18kDa
NCBI Official Full Name
interleukin-26
NCBI Official Synonym Full Names
interleukin 26
NCBI Official Symbol
IL26
NCBI Official Synonym Symbols
AK155; IL-26
NCBI Protein Information
interleukin-26
UniProt Protein Name
Interleukin-26
Protein Family
UniProt Gene Name
IL26
UniProt Synonym Gene Names
AK155; IL-26
NCBI Description
This gene was identified by its overexpression specifically in herpesvirus samimiri-transformed T cells. The encoded protein is a member of the IL10 family of cytokines. It is a secreted protein and may function as a homodimer. This protein is thought to contribute to the transformed phenotype of T cells after infection by herpesvirus samimiri. [provided by RefSeq, Jul 2008]
Uniprot Description
May play a role in local mechanisms of mucosal immunity and seems to have a proinflammatory function. May play a role in inflammatory bowel disease. Activates STAT1 and STAT3, MAPK1/3 (ERK1/2), JUN and AKT. Induces expression of SOCS3, TNF-alpha and IL-8, secretion of IL-8 and IL-10 and surface expression of ICAM1. Decreases proliferation of intestinal epithelial cells. Is inhibited by heparin.
Research Articles on IL26
Similar Products
Product Notes
The IL26 il26 (Catalog #AAA3216553) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The IL26 antibody - N-terminal region reacts with Dog, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's IL26 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the IL26 il26 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IKAAWLKATI PEDRIKNIRL LKKKTKKQFM KNCQFQEQLL SFFMEDVFGQ. It is sometimes possible for the material contained within the vial of "IL26, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
