Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.73KD).)

Mouse anti-Human NCK1 Monoclonal Antibody | anti-NCK1 antibody

NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK) APC

Gene Names
NCK1; NCK; nck-1; NCKalpha
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NCK1; Monoclonal Antibody; NCK1 (Cytoplasmic Protein Nck1; MGC12668; Nck1; Nck-1; Nck Adaptor Protein 1; SH2/SH3 Adaptor Protein NCK-alpha; NCK) APC; anti-NCK1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG
Clone Number
1A1
Specificity
Recognizes human NCK1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NCK1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa185-294 from human NCK1 (AAH06403) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEM
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.73KD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.73KD).)

Western Blot (WB)

(NCK1 monoclonal antibody Western Blot analysis of NCK1 expression in HeLa NE.)

Western Blot (WB) (NCK1 monoclonal antibody Western Blot analysis of NCK1 expression in HeLa NE.)

Western Blot (WB)

(Western Blot analysis of NCK1 expression in transfected 293T cell line by NCK1 monoclonal antibody. Lane 1: NCK1 transfected lysate (42.9KD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NCK1 expression in transfected 293T cell line by NCK1 monoclonal antibody. Lane 1: NCK1 transfected lysate (42.9KD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged NCK1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged NCK1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-NCK1 antibody
NCK adaptor protein 1, also known as NCK, belongs to the adaptor family of proteins. The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Overexpression of Nck resulted in transformation of NIH 3T3 and 3Y1 rat fibroblast.
Product Categories/Family for anti-NCK1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
35,511 Da
NCBI Official Full Name
Homo sapiens NCK adaptor protein 1, mRNA
NCBI Official Synonym Full Names
NCK adaptor protein 1
NCBI Official Symbol
NCK1
NCBI Official Synonym Symbols
NCK; nck-1; NCKalpha
NCBI Protein Information
cytoplasmic protein NCK1
Protein Family

NCBI Description

The protein encoded by this gene is one of the signaling and transforming proteins containing Src homology 2 and 3 (SH2 and SH3) domains. It is located in the cytoplasm and is an adaptor protein involved in transducing signals from receptor tyrosine kinases to downstream signal recipients such as RAS. Alternatively spliced transcript variants encoding different isoforms have been found. [provided by RefSeq, Jun 2010]

Research Articles on NCK1

Similar Products

Product Notes

The NCK1 (Catalog #AAA6137802) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NCK1 (Cytoplasmic Protein Nck1, MGC12668, Nck1, Nck-1, Nck Adaptor Protein 1, SH2/SH3 Adaptor Protein NCK-alpha, SH2/SH3 Adaptor Protein NCK-alpha, NCK) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NCK1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NCK1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NCK1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.